SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr5P02880_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr5P02880_001
Domain Number 1 Region: 670-724
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000221
Family PHD domain 0.0019
Further Details:      
 
Domain Number 2 Region: 863-934
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000531
Family N-acetyl transferase, NAT 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr5P02880_001
Sequence length 1470
Comment pep:novel chromosome:MA1:5:1938234:1956947:-1 gene:GSMUA_Achr5G02880_001 transcript:GSMUA_Achr5T02880_001 description:"Hypothetical protein"
Sequence
MPDSLSLGYWCFVAMSSVEEETVAMKRGVANGVSASKEVREPNRQKKRRLVLSDSDSDDC
LFSLSKVDHRTDQNGDSSSIGEDNGVERMEEKGKVEVENQKRVLRPDFMKRNEELIVSDK
KEVTKPELERRSREPADAKVPAKKLEMDFSERGGGNNSEISKRKLLHGRDDTNDMEAEKD
VGSKPVDPTSSKRDGLMENDTQTNSPRTSRREAEKDKPIESSGNQTLRMRHNSSSSANEK
RADTAMSQSKAGVLTLQGKNGVLRVSPSNKRADGLKNLHSKRKDEEKLKAVGSPKDSARG
TPKRPSLSPDQRVHGKSSTGATFSKYQSRKAKIDKTEEIRSSRRKTKPVIVSPKREKKRT
DKLKNRTGLKIKSRSSSKAAFIAKQKLNKASVARSTEKQNLRDQIKNILLNAGWTIDLRP
RKGRNYEDSVYIPPEGKSGYWSITKAYAAYQEQLNRACNERGKNSSGRSSKTSSGSDSVV
PMESLDILKRIVNKRGRREELKETQRGKKKKSNSALPSNKKIAVGSTVLKHVQKGRNKQR
GCALLARGSNQEAEAEDNDYVPYIWKRTVLSWMIDMGVLPINGKVKYMNQRKTKTKLEGR
ITRDGINCSCCSKIIPVPKFELHAGSKLLQPSQYIFLEDGGVSLLQCQLDAWKKQDESER
QGFYCVDVSGDDPNDDTCGICGDGGDLICCDGCPSTFHLSCLGIEKLPPGDWHCTNCCCR
YCGGISTDATRDTDGTVSSLLSCHQYHQGCVPDAESVSAITKNSGMSFCAQSCRKVFKRL
QKILGIKNDLEAGFSWSVIRRFDEDAPKTPLKSHLIAECNSKVAVALAVMNECFLPIIDQ
RSGVNLIHNVVYNCGSNFNRLNYRGFYSFILEQGDEIISVASIRIHGTKLAEMPFIGTRN
MYRRQGMCRRLLDGIESALFSLDIEKLVIPAISELKDTWSNVFGFKPLEVSQELEVRSIK
ILVFPGTGLLQKPLLKMHSSVQYSAVDGVDNDIKHQHQTISTHVSSEFSSIEPNLHIPGQ
DVVHCINPNQDAEPSLSSSRVSPDSSDSPRPNCKSQENKILETAGDLCMHNFPGGGLSGS
HDEDKCQVDFSTNQQAELISELTLFDSQEGENVEANPSADLQECDSVSKQSYLDGFASDT
KKSGSASLSMHSTEFNLLQHKLEDHCTPLGIDTFTLKQNVRMNVELPLGSLESTSTPSLQ
CHVTTKAHSPNSSESNDQVSSESAHDANHFEKSLMVHLEPCFLLSNEMMHSICKVKAKDS
ILDPKSSVNDGNSEPYAFEIVKRCLNVAATEESGASCSSAAVPDSDENARFSIQQSILDT
VYVTNGTVCESNLSCVVKSCRIPSETNHSHMACSGMLDADIHDVQPNLTPINFVAADILD
KSHHICNEFTNGTEKWVKLNIRDLKVRPKSPLSVFRRNNNYQFVTKGDCVLSSSSSSRVL
EVLLAIDGQILKVLFLNSKALMGNNEGHFP
Download sequence
Identical sequences M0SV67
GSMUA_Achr5P02880_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]