SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr5P06610_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr5P06610_001
Domain Number 1 Region: 167-246
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.07e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr5P06610_001
Sequence length 481
Comment pep:novel chromosome:MA1:5:4857077:4860640:-1 gene:GSMUA_Achr5G06610_001 transcript:GSMUA_Achr5T06610_001 description:"FYVE zinc finger domain containing protein, expressed"
Sequence
MEDSYSTSSSSKNGNCCSSELIQASNPGIVCPQISAKRKSRKYFYYDSPLYEETGIWIPV
SVPPMSESDHDEWSRGFGCNGGYFPEGEFSWDQSLGVDKEMTMWDVVSEMLLVVRHKLSG
LASSDLKSCGMSWISIELLEETWKEMANSLAETNYGHSMEILETDPPKWLPDSAAASCML
CNVRFHPFMCFRHHCRFCGGIFCGDCSTGRSLMPPKFRIADPQRVCDVCYVRLKSVQHYL
MDQVSNASQLLTQDLTDLSTLRSWLNFPWGRTMEYEIYKAANIVRSYSKVGSLRPEKSIP
DAILKQAHGLAILTVVNVGLMVTYKVGTGLVVARREDGSWSPPSAISSFGLGWGAQAGGE
LTDFIIVLRNKAAIRTFSGNAHLSVGAGLSAAAGIVGRAAEADIRGGDGGYAACYTYSCS
KGAFVGCALNGNIVIARTSENSRFYGAPLKASDILLGSLPRPPAAAVLYNALSDLFLKLK
R
Download sequence
Identical sequences M0SW90
GSMUA_Achr5P06610_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]