SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr5P06720_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr5P06720_001
Domain Number 1 Region: 114-199
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000219
Family PHD domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr5P06720_001
Sequence length 425
Comment pep:novel chromosome:MA1:5:4919567:4923933:1 gene:GSMUA_Achr5G06720_001 transcript:GSMUA_Achr5T06720_001 description:"Putative E3 ubiquitin-protein ligase UBR7"
Sequence
MADAFEDEAEQTVTIDEYIEELEAEELEADLVLGGDEGKECTYPRGYMKRQAIFSCLTCV
PGGTAGVCTACSLSCHDGHEVVELWTKRKFCCDCGNSKFGGVLCKLCPDKETENSENSYN
HNFRGSYCTCGRPYPDPDAKEQIEMIQCCICEDWFHENHLGLNSSDEIPRDEDGEPLYED
FICQQCAITCSFLKLYPAYIWATSKQNNAPSVSNAENVVDNGSLDSRYPDKNEDNVPVAE
ILGHSSSSGSKPESVSTKEESVCDEGTEINVSSEDTKPCPENQELSAKCIIGVDINVSSV
LLEKMEPMFLSKKWRELLCKCGTCYEFYTRNGIEYLTDKEDTIEAYEKMAKSKREEKLKQ
QEGAELNFLNTLNHVQKIEILSGIADMKNEFRTFLESFDQSKPVTSEDIKGVFENLAKKK
KQRLS
Download sequence
Identical sequences M0SWA1
GSMUA_Achr5P06720_001 XP_009399830.1.42102 XP_018681850.1.42102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]