SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr5P07190_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr5P07190_001
Domain Number 1 Region: 43-280
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.42e-47
Family Ankyrin repeat 0.0000971
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr5P07190_001
Sequence length 526
Comment pep:novel chromosome:MA1:5:5199428:5203436:1 gene:GSMUA_Achr5G07190_001 transcript:GSMUA_Achr5T07190_001 description:"Ankyrin repeat-containing protein At3g12360"
Sequence
MDQATSPKTAPALVLSNSGKRIDPSRKKKYVKQVTGRHNDTELHLAAQRGDLAAVRQILG
QIDAQETPLFIAADKGFLDIVVELLKYSDQDSLCRKNRSGFDALHVAAREGHQAIIQVLL
DHDPTLIKTFGQSNATPLISAAIRGHTEVVNLLLKRDASLLELSKTNGKNALHFAARQGH
VEIVTALLEKDPQLARRTDKKGQTALHMAVKGTSCEVVNALVDADPAIVMLPDRAGNTAL
HVATRKKRAEIVKVLLHLRDTNVNALTRDHKTALDIAESLPLSEESAEIKEWLSRYDAVR
ANELNQPRDELRKTVTEIKKDVHTQLEQTRKTNKNVYGIAKELRKLHREGINNATNSVTV
VAVLFATVAFAAIFTVPGGTEDTGIAIVVRSGSFKIFFIFNAVALFTSLAVVVVQITLVR
GETKAERRVVEVINKLMWLASVCTTVSFIASSYIVLGRHNQWAAFLVTVIGGVIMTGVLG
TMTFYVVRSKRTRSIRKRAKSLKSGTSSWHHNSELSDSEVDRIYAI
Download sequence
Identical sequences M0SWE8
GSMUA_Achr5P07190_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]