SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr5P08160_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr5P08160_001
Domain Number 1 Region: 209-293
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.93e-19
Family Ankyrin repeat 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr5P08160_001
Sequence length 427
Comment pep:novel chromosome:MA1:5:5917438:5919404:1 gene:GSMUA_Achr5G08160_001 transcript:GSMUA_Achr5T08160_001 description:"BTBA3 - Bric-a-Brac,Tramtrack, Broad Complex BTB domain with Ankyrin repeat region, expressed"
Sequence
MEETLKALSLDYLNLLINGQAFSDVTFSVEGRLFLYSGQVSVVPQKHEPRPSCGERGCWH
THCTAAVDLALDTLTAARSFGVKQLEQITEKQLASMAEKASIEDVMKVLMASRQQDMQQL
WTTCSHLVAKSGLPAEVLAKHLPIDVVARIEELRLKSSLARRSSFVAHHHQIDVSGSSAD
LEDHHHKIRRMRRALDSSDVELVKLMVMGEGLNLDDALALHYAVENCSREVVKALLELGA
ADVNSPAGPTGKTPLHIAAEMVCPDMVAVLLDHHADPNVRTVDGVTPLDILRTLTSDFLF
KGAVPGLSHIEPNKLRLCLELVQSAALVISREEANCGGGTGGAGSNPTTAIYPRMNPGTG
ACDASSSTSGMVNLSLDSRMVYLNLGMAAQFGGKMNDGGGDGSSSSRSQGGGGGIGPSSM
YPAHGFP
Download sequence
Identical sequences M0SWP5
GSMUA_Achr5P08160_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]