SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr5P08220_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr5P08220_001
Domain Number 1 Region: 266-657
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.44e-97
Family Regulator of chromosome condensation RCC1 0.00046
Further Details:      
 
Domain Number 2 Region: 19-127
Classification Level Classification E-value
Superfamily PH domain-like 1.67e-27
Family Pleckstrin-homology domain (PH domain) 0.0038
Further Details:      
 
Domain Number 3 Region: 656-727
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000101
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0022
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr5P08220_001
Domain Number - Region: 872-943
Classification Level Classification E-value
Superfamily Tropomyosin 0.0124
Family Tropomyosin 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr5P08220_001
Sequence length 1100
Comment pep:novel chromosome:MA1:5:5945975:5956339:-1 gene:GSMUA_Achr5G08220_001 transcript:GSMUA_Achr5T08220_001 description:"Putative E3 ubiquitin-protein ligase HERC2"
Sequence
MAAASAAADHGRTGHAERDIEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESTLIWFS
GKEEKHLKLSHVSRIMPGQRTAIFQRYPQPEKECQSFSLIYSDRSLDLICKDKDEAEVWF
AGLKTLIPRSHHRSWRTESRSDGASSGTNSPRTYTRRSSPLNSPFGSSDSMQKDGSDTFR
VRSPYGSPTKNGLDKSFSEVVSYAVPPKSFFPSDSATGSLHSLSSGCSDNINGHARAIAT
DAFRVSLSSAVSSSSQGSGHDDGDALGDVFIWGEGTGDGVLGGGSLRLGSYSGIKLDSLA
PKALESAVILDVQNISCGGRHAALVTKQGEIYSWGEESGGRLGHGVDADVSQPKLIDALV
NMNIELVACGEHHTCAVTLSGDLYTWGDGTSTLGLLGHGNEMSNWIPKRVNGALEGIHVS
SVSCGPWHTAVVTSAGQLFTFGDGTFGVLGHGDCKSVSVPREVESLRGLRTVRAACGVWH
TAAVVEVMSGNSSSSNCSSGKLFTWGDGDKGRLGHGDKENKLVPTCVAALVEPNFCQVAC
GHSLTVALTTSGHVYTMGSAVYGQLGNPQADGKLPMRVEGKLLKNFVEEISCGAYHVAVL
TSRTEVYTWGKGANGRLGHGDTDDRNSPTLVEALKDKQVRSVVCGTNFTAAICIHKWVSG
VDQSMCSGCRLPFSFKRKRHNCYNCALVFCHYCSNKKSLRASMAPNPHKPYRVCDNCFIK
LSKPLESDSSLHSAASRRGNIIKGFTEMTEEDKLDPKSNVQIPRISSIESFKQIENRSSK
KNKKFEFIGSRVSPIPNGTSRWGALNISKSFNPASGTSKKFFSASVPGSRIVSRATSPVS
RRPSPPRSTTPTPTLGGLTSPRIILDNSKGGTDSISQEVLKLRAQVANLARKAQLQEVEL
ERATKQLKEAISIAEEEAAKSKAAKEVIKSLTAQLKSMAERLPIGAAENSKLPSLASLNT
TPTSSGVSVAAVERLSSMLTSQETDANVSSCVLVSNGPSSTGSHNNGGTPVARNGSKVID
ADPDRETEWVEQDEPGVYITLTSLPGGVRDLKRVRFSRKRFSEKQAEQWWAENRARVYEQ
YNVRMVDRSTISIRSDERSR
Download sequence
Identical sequences M0SWQ1
XP_009399981.1.42102 GSMUA_Achr5P08220_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]