SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr5P09840_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr5P09840_001
Domain Number 1 Region: 44-288
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.51e-46
Family Voltage-gated potassium channels 0.0032
Further Details:      
 
Domain Number 2 Region: 518-695
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.44e-43
Family Ankyrin repeat 0.0003
Further Details:      
 
Domain Number 3 Region: 292-487
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.44e-38
Family cAMP-binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr5P09840_001
Sequence length 820
Comment pep:novel chromosome:MA1:5:7059592:7063293:-1 gene:GSMUA_Achr5G09840_001 transcript:GSMUA_Achr5T09840_001 description:"Potassium channel AKT1"
Sequence
MCGHQTERDLSRDGSHYSLSSGILPSLGARSNRRVKLRSSIVSPYDRRYRTWETFLIVLV
IYSAWVSPFEFGFLDNSKGSLALADNIVNAFFAVDIVLTFFVAYLNRTTYLLVDDHKKIA
VRYLTTWFILDVASTIPSEIALRILPSSLRSYGFFNMLRLWRLRRVSALFARLEKDRSFN
YFWVRCAKLICVTLFAVHCAGCFYYLLAARYHDPSGTWIGASMADFLERSLWDRYVTSMY
WSITTLTTVGYGDLHAENTREMIFATIYMLFNLGLTAYLIGNMTNLVVHGTSRTRRYRDT
IQAATGFAQRNQIPERLQEQMISHLSLKFRTDSEGLQQQEILDSLPKAIRSSISHYLFYS
LVQQVYLFRGVSHDLLFQLVSEMKGEYFPPREDVILQNEAPTDFYILVTGSAELIDHRSG
SEEASCLLNDCDLVGEIGILCYRPQLFTVRTRSLCQLLRLNRTVFLNLVQSNVGDGTIII
NNLLQYLKEQMDDPLMEGLLRDIETMLTRGRLELPLTLSFAVVRGDDLLLHQLLRRGLDP
SESDNNGHTALHIAASKGNEHCVRLLLDFGADPNSLDSEGSVPLWEAILGKHEQVVKLLI
DNGAHLSAGDMGHFACTAAAQNNIELLEDIIRHGGDVTAEKKDGSTALHRAVCEGNPRLA
EFLIQHGADMDKPDHHGWTPRSLADQQGHDEIKALFDVTVVVVAVRGAGEERAGTAGKLP
QLAVWDHIGCQLQQQAEPQRPAVICCWSAEAYLVLLPDSLHELLDIGSKKFGFLASKAFT
KDGAEIDDVKLIRDGDHIVVAGDDSDGISAHGSERLSQST
Download sequence
Identical sequences M0SX63
GSMUA_Achr5P09840_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]