SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr5P11650_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr5P11650_001
Domain Number 1 Region: 241-570
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 4.53e-82
Family Regulator of chromosome condensation RCC1 0.00052
Further Details:      
 
Domain Number 2 Region: 14-124
Classification Level Classification E-value
Superfamily PH domain-like 4e-22
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 3 Region: 572-643
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000959
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr5P11650_001
Sequence length 970
Comment pep:novel chromosome:MA1:5:8326278:8333568:1 gene:GSMUA_Achr5G11650_001 transcript:GSMUA_Achr5T11650_001 description:"Putative Probable E3 ubiquitin-protein ligase HERC2"
Sequence
MAENFGRRTPSVREVEQAITALKKGAHLLKCGRRGKPKFCPFRLSTDEKSLIWYSGEKEK
HLNLNSVSKLVPGQQTANFLRQNQADKKIQSFSLVYENGQRSLDLICKDKEQAESWCLGL
TALVSTSHQPRSLAHVRSSRWAHSCVNSPAKYAATNHRLGILQGSAKLAKVWRHPMISLL
QRTLSDIQSYLDKILPRLPHVVSYGDEDKIESNLSKGQRMHPVSKLSSSDHESPKLYVND
GLKDVFIWGKGVGGVLGGGIDSSLPRLLDSTRALDVRNVSCGENHAALVTKQGEVFCWGL
ENGGRLGHKVNMDVPCPKLWFPHTISGPLDDICISRVACGEWHTAIVSSSGQLFTYGDGT
FGVLGHGNVQSLSRPKEVESLKGLRVKSVACGPWHTAAVVEIMVGRVKGNTPGGKLFTWG
DNDKGRLGHADKDRKLTPTCVASLVDCDFVQVTCGTTLTVALTVTGIVFTMGSSANGQLG
NPQAEDVSITRVEGLLKTEYVKEISAGSFHVTVLTTKGKVYAWGRGGNGQLGLGDNKDRN
SPTPVESLEDRHVESIACGSNFTVITCLHKFISSKDQSICTGCRMVFGFARKKHNCYNCG
FMFCHHCSSKKAMNAALAPSRCKRYRVCNSCFTQLQKISDTRMNTETSTPRPLLLTTEET
KPVEVDAESIREKRHNQHLSSPLITIRRWGHVPRPLQFLEHAKENSLKVVPISGQENSDI
MLPKASSLRKDLDSVDKVLREELLRLQTELHDNLQLIQPQAMSLTQKCQSRSQKLQQCKR
KIEETWLLAKDEAEKCKAANAVIKILTSQQMNALTEKISSRRQTSRSTMEAVSTCHETKF
PVPEGEKLVSSSRHQNKDVNESIKHQTCTSSSNDAPLAATSAKDCKPKESKDEWVEQVEV
GVYITFITLPNGQKGLKRVRFSRKHFSEKEAEKWWEENQRKLYYSKLNENIRVPLMDIGT
VFWTQSYGNL
Download sequence
Identical sequences M0SXP4
GSMUA_Achr5P11650_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]