SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr5P13430_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr5P13430_001
Domain Number 1 Region: 4-59
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000198
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr5P13430_001
Sequence length 122
Comment pep:novel chromosome:MA1:5:9641276:9641708:1 gene:GSMUA_Achr5G13430_001 transcript:GSMUA_Achr5T13430_001 description:"zinc finger protein, putative, expressed"
Sequence
MDTTMTVCSMCGDIGFADELFQCIRCRSRFQHSYCTNYYEEEGSETVRVCDWCLREERDG
AKRRGIHRKKVTGGCTSETSSNKAEQRSDREESRRGRGKSSGGAAASRPTARRYKLLKDV
LR
Download sequence
Identical sequences M0SY72
GSMUA_Achr5P13430_001 XP_009400950.1.42102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]