SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr5P14580_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr5P14580_001
Domain Number 1 Region: 8-130
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.02e-26
Family Ankyrin repeat 0.0009
Further Details:      
 
Domain Number 2 Region: 465-511
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000259
Family RING finger domain, C3HC4 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr5P14580_001
Sequence length 517
Comment pep:novel chromosome:MA1:5:10521701:10527135:-1 gene:GSMUA_Achr5G14580_001 transcript:GSMUA_Achr5T14580_001 description:"Probable E3 ubiquitin-protein ligase XBOS34"
Sequence
MGAQQSKEELLYQQVNYGNIEGIRALRSQGAGLEWMDKEGKTPLIVACLRHDLLPVAKAL
IEMGANVNVYRPGCHAGTPLHHAAKKGLEQTVHLLISNGANPFIMNDDCHTALDLAREKG
HINVVRAIENRVSLFAGWLREVHGPGFLEALARQLLTRKIWVVVLPSDARNPTRPLKFEL
AIYSDLQTARPRTVIQLWNVHIEEPKFNQVDPAVIIVDKATRARYKFLSAYEGDKQQLRW
FFSACQGISQVMDCISAMPTGTSVPSPPQVISHASTQSTAAPTSNPEDIELEMAINASTR
TAIAEGMPPLIQSDPQTSNTNGWGSSSDNSSYNGWGTPDVDAPSKVNGQVLMNEPNTCNG
WAVPEVQLNTNALQPYMRNPDTPVVQSSQGAPSTQVVPSAPPMMADTFYDGPIHYPSIDC
SPIDLSMPLVKTASGTSEAKDSSTSSSSKTGTGEDKAGSSSTTGCCVICLDAPVEGACIP
CGHMAGCMSCLREIEAKNWGCPVCRTKINQIIKLYAV
Download sequence
Identical sequences M0SYI7
XP_009400812.1.42102 XP_018682229.1.42102 GSMUA_Achr5P14580_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]