SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr5P16220_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr5P16220_001
Domain Number 1 Region: 232-349
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.07e-19
Family Ankyrin repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 7-154
Classification Level Classification E-value
Superfamily POZ domain 1.57e-19
Family BTB/POZ domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr5P16220_001
Sequence length 441
Comment pep:novel chromosome:MA1:5:13653041:13655162:1 gene:GSMUA_Achr5G16220_001 transcript:GSMUA_Achr5T16220_001 description:"Putative Regulatory protein NPR1"
Sequence
MEESLKSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCVLAARSLFFRKFFCGAEPSSP
SGLLLLNPHDRHSPRVIPVNYVSYEVFLLMLQFMYSGQVPLVPQKHEPRPSCSDRGCWHT
HCTAAVDLTLDTLAAARSFGIEQLALLTQKQLASMVEKATIEDVMKVLIASRKQDMNQLW
ITCSHLVAKSGIPPEVLAKHLPIDIVAKIEELRLKSSLTGRSFITHHHSLEAAGASTELE
DHHKIRRMRRALDSSDVELVKLMVMGEGLNLDDALALHYAVENCTREVVKALLELGATDV
NFRAGPAGKTPLHIAAKMVCPDMVAVLLDHHADPNIRTFDGVTPLDILRNLTSDFLFKGA
VPGLTHIEPNKLRLCLELVQSAALVMSREDAKSGGGGNHPHSAIYPPMNQQESNTCNANH
TSGGGVGNIGLSSMFSSHGFP
Download sequence
Identical sequences M0SZ01
GSMUA_Achr5P16220_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]