SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr5P18040_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr5P18040_001
Domain Number 1 Region: 962-1018
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000187
Family DNA-binding domain of telomeric protein 0.032
Further Details:      
 
Domain Number 2 Region: 595-654
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000354
Family PHD domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr5P18040_001
Sequence length 1025
Comment pep:novel chromosome:MA1:5:19286067:19298701:-1 gene:GSMUA_Achr5G18040_001 transcript:GSMUA_Achr5T18040_001 description:"Putative uncharacterized protein"
Sequence
MACDKSGCRLGSALRVRDGIELPSRNQKHPHVQRPRQRSRPQIGPVAVTGPDVDLLSLSA
SIPTSPILTVQNHGGKRSTTEPLKVSSDEAPPIASSSSSLCPKEWQPSLPVDRGHCHLPR
RPPPSPRRRRFFFPCSFVLCFSMTSNPLPWHWVIETLANCKQVDTSVLGDLILKDAEILI
GAPVPVREKVALRYLEKLVDVDREEGPSEWASSGKIDVNRSCEEVLSREMRKVARLFNLE
KDKVNLLTPDLHKFILQKRASLSGSSLDKIKAAILQGHCQALLPLKEISGLLVQNEVDNF
QGKVSDESQRAKKLQVSTYNTEMESLRQSPAAPAPDGCNGLLQEECTRSIPQFPNQIVEG
FKRMLQGDGVNNGGSYQNINEFTGNERKKIKLSTKDYHAQSNEKDSGLLAPGSNTVISQE
DASESMEHLVKLNVTATNDKTIIQGSMCELPGRENIDAGGVQMPQPQQISSCPVPANINI
IMQEDSPRVGQRLPLDVFVMDDDHAHLMKDATITKLPCNEGGSLQHVSVDGSGEKMNSAF
FEKSRLNVQLSVTPEIAGDGDGSCNVLSDAELHNDIFAAEKHRLLSSQVHINDDSAIGGC
TEQGLCIKCDKGGELLTCGGNGCLISVHESCLGSSPIFDTSGLFYCPFCSYTRAAISYRK
VKKNFIQARRVLSEFIGGNFVRGHRKVSPSGVHKETNQTRVVDNSCSEHSAGSSQCKGNK
LNEISVEVNEHSRVERERACDNCTSLMLNGNADLSKVHIVPQSNGEQVEVAEHQHLREPY
AAADNCRGDSCHARDIDVRQGDIVMIEDHSNVQQLKTPEEEGLMLNGNADLSKGHIVPRS
NREQVEVAEHQHLREPYAAAVNCPGDPCHARDINDVRQDDIVMIEAHSNIQQLKTPEEEG
HASVDKVLAGEKHGKRQLEDILVVDNNGRNKSSPAKSKRHISRAKRYSNPILPPTRRTKL
SWTPEEEEFLREAVHELGEKNDGSIPWVKILELGRHVIHKTRQPGDLKDKWRNMKKKEAS
RTLNR
Download sequence
Identical sequences M0SZI3
GSMUA_Achr5P18040_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]