SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr5P18840_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr5P18840_001
Domain Number 1 Region: 14-72
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000624
Family PHD domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr5P18840_001
Sequence length 1097
Comment pep:novel chromosome:MA1:5:20344004:20351535:-1 gene:GSMUA_Achr5G18840_001 transcript:GSMUA_Achr5T18840_001 description:"Hypothetical protein"
Sequence
MKGRSQRLPPAEPPDDWGDGSWTVDCSCGVTFDDGEEMVSCDECGVWVHTRCSRYVRGEA
SFACHNCKAAARRLRSASAAAVGHFPLPVDTEETEVAQLLVELPTKTDIPLEDRVHVQGV
PGGEPNLFGGLSSIFTSQLWKCTGYVPKKFNFRYREFPCWEEDEEKKEGEEEAENPANRG
ADVLFSLSKEIIPYVPVKKFDAAIKEGEGKVSSGSRSSLSCRKKDRSRLRTVGQANVAKK
RREEPGETKDWTGKKKARSSAEKIAGDTKRRGSVPFTGMKKFEFQKDKDLQLEEASVPGP
KSEDQTEELHSASCFAGQPKGMGHSDKPKHLLADSSMIAREVKVEKVDQLETVKTEKSDN
SPKMDVASRGGTSQIAKESSTDEVSCLFIVDAFIYINIKCDLIFCWLTVQISLIASPIVS
SRAMYCMKEPKDESNFEGRLAKVSSSVVMDSGTSKPASADLANGCKELLDKPVLSGSKDA
VILSTKMDANEVKIEGADDLSTGNLNFTAPCTAAKLPAIDSQQHGQLLNQLSEGIQDQEN
KSSFPSHGHWSQDVSRECNEFKDSITSRTGELLKHCNQVENSPEQKGTLEIGHGTKNFNE
STNSRLQDLNSLIPDAVNLAVGVIKDSSTSFSPVVTKLSVPCTNMSSITSTSSAAKDSKE
ELPFQSSKASGKEDRTAVLRTHDIAGSLQSQVASVQIKQTSTNLSQRTERSHQSAPYTSS
KVLSTSIFMHPSASSNATTTLSDEELALLLHQELNSSPRVPRVPRVRQAAGIQSTPTTGM
SVLSKRPSVSGGKDQVSVFRRKNKEDASKYVTRNSQELNDESRKKGRLSSFPDQRHQQSS
ISSEKKKESQIRPPDLALIKNISLASGEGEKSDPFSSSEVSEHITSIACSSPRDIPRDEG
GVIVRTLPGLIDEIMSKDKHIRYEELCNAVRPHWHDLRKPNGERYAYPSYLHAVHDCLRN
RSEWAHLIDQGPKTNSSKKRRKAEVDPDVATIESENEKVRTRASKEEDNAVDSHREDFPK
RKRNARKRRRLELRGTGVMEEGRKRRSRAAVSDYYSAALSHSSNEGNESLFSEDESQVAG
PHAGGTETSSSSSDDST
Download sequence
Identical sequences M0SZR3
GSMUA_Achr5P18840_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]