SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr5P19380_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr5P19380_001
Domain Number 1 Region: 71-138
Classification Level Classification E-value
Superfamily RING/U-box 3.53e-19
Family RING finger domain, C3HC4 0.005
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr5P19380_001
Domain Number - Region: 18-45
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0187
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr5P19380_001
Sequence length 191
Comment pep:novel chromosome:MA1:5:21042681:21048570:-1 gene:GSMUA_Achr5G19380_001 transcript:GSMUA_Achr5T19380_001 description:"E3 ubiquitin-protein ligase RING1"
Sequence
MSSAGATGSSSAAAAVTAEKRYLCHQCNRTFTAAGTRLACAHCHGDFLIQRLSENDPNQY
GTPPASKAAVESLPDVKITEGLLASDEAQCSVCMDLFEMDAVAKQMPCNHVYHKECILPW
LELHNSCPVCRYELPTDDPDYERHRTPRSNAVNPGGGLTTGAVAGEVDGNLPVRTSERSS
GDHGYPASGTH
Download sequence
Identical sequences M0SZW7
GSMUA_Achr5P19380_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]