SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr5P23950_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr5P23950_001
Domain Number 1 Region: 50-139
Classification Level Classification E-value
Superfamily BRCT domain 4.36e-23
Family DNA topoisomerase II binding protein 1, TopBP1 0.056
Further Details:      
 
Domain Number 2 Region: 372-427
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000212
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 462-516
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000816
Family PHD domain 0.012
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr5P23950_001
Domain Number - Region: 334-378
Classification Level Classification E-value
Superfamily gp9 0.0602
Family gp9 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr5P23950_001
Sequence length 524
Comment pep:novel chromosome:MA1:5:25486869:25491267:1 gene:GSMUA_Achr5G23950_001 transcript:GSMUA_Achr5T23950_001 description:"Putative uncharacterized protein"
Sequence
MCRGAAEAPAPIFQTPKIETLPSSSRPKESAMESGGPREDDFSGRFQGNGIRPIQGMESV
VATVSGYHGTERFKLIKLIAQTGASYTGAMTKSTTHLVCWQFEGKKYDMARRTGAHIISH
RWFEDCLKERKRLPEDPYAAQSGQETGTITWEMPAALDTSGKGKTIISAERCMLSDNFSA
LNCRNIVEIDASYLDWSDSQLLHKCRESSTFPKVCSSSKKRNLFDATQDVTCKPTRRSNR
LKKKAYCNLLNYVSLGQKQGTSVKKFSSQVEIIDLDSTCENTSRRRLGSSSQGKTTDFML
SDHEGSGIEGLEQDGVEELRNDNILSDNGIFSDNENFECIGKMLGSSENARNDNEHHKEG
ENLYEAGAYKQAELSCVICWTEFSTTRAVLPCGHRFCYSCIQGWVDCLASRGKISSCPLC
KSSFTSMRKMDTSTDQKIYSQTIPSESSNIDIIMVSNNGNDSARASMPMDPVCSECHNRE
PEDLLLCCCICQSQWVHSYCLDPPVSPWTCIHCRDLRTLYQRFR
Download sequence
Identical sequences M0T170
GSMUA_Achr5P23950_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]