SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr5P27280_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr5P27280_001
Domain Number 1 Region: 281-361
Classification Level Classification E-value
Superfamily SBT domain 6.15e-36
Family SBT domain 0.0000356
Further Details:      
 
Domain Number 2 Region: 845-950
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000839
Family Ankyrin repeat 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr5P27280_001
Sequence length 1065
Comment pep:novel chromosome:MA1:5:27822452:27832646:-1 gene:GSMUA_Achr5G27280_001 transcript:GSMUA_Achr5T27280_001 description:"Putative Squamosa promoter-binding-like protein 6"
Sequence
MDAAASLAAARSTLEDLRSIDFSSPSEKYEEEPPGSEQLGHTKEGAASSRQAECAMEGQR
EQRTTGEAPPPSRRRSKQETQNEPGWYRRTQEVQRRQKTVRWRTLCRGQGSRAPQPSPPH
PAGRRSLFAPDGVVMAFATSRFTSANLGLLNCFEVFALMETRIGSKSHQFLAAGTSNVNV
IGQKGVEWDLNDWRWDGEHFVATPLDAVPADCWSKHLRQDAAKGLVLNSPSSSSEGADCG
LVEKDNGESEKKRRIVVVEEDESCVKNEKKNKSQGGSSSNPTCQVEGCDADLCDSRDYHR
RHKVCEMHAKASSAIVRNAIQRFCQQCSRFHLLEEFDEGKRSCRRRLAGHNRRRRKNHPD
DNVNGSSSIDERASSYLLISLLRILSNLQSNNSERSQDQELLTHFLSNLGTLANSLDPSD
LSRLLRAAQDPPKLVTTAGTSSEAIITSVPNGVPEQDSRRPLGSAAKMTCTPGVQGPPQE
TDHVPSVADVPKIGRESSEELVIDRVRMKDFDLNSDPRDCKKGEMPATSLCTGIGSPNVP
SWLLQNTCQLSPPQTSGNSDSTSNHTQSRSHGDAQCRTDRIIFKLFGKNPHDLPLVLRAQ
ILDWLSNSPTDIESYIRPGCIILTIYLRQPEFAWAQLCNDLSSYLARLLHNSHDFWTTGW
IFARVQNYAAFIYDGQVVLDMPLLVGHSNHCKILSVTPIAVSHSTNVNFTVKGFNIVQPT
SRLLCSFDGKYLFQETTQDLVEGFSRCAGHESAQCLSFSCLLPDKTGRGFIELEDCGLTN
GFFPFIVADEDVCSEIRVLEKSINVGSCDDQLQERKDTDNARNQALDFINELGWLLRRNH
MLALSVNLLHSAVQINSKAMVELLLRYKPSKPSKQMDPDQFLFRPDMLGPSGLTPLHIAS
STSGAESILDALTNDPGQLGINAWKNLRDSTGFTPKDYALVRGHDSYLRLVQNKIDKQFH
LNQVVLNISGDASYKTVDVLKSVKADASDRTTWLSSKQPPSCNRCSQQLVYQNSVARTML
YRPVMLSLVGIAAVCVCVGLLFKTPPEVFYVFPSFRWELLEYGFM
Download sequence
Identical sequences M0T253
GSMUA_Achr5P27280_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]