SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr5P28260_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr5P28260_001
Domain Number 1 Region: 109-179
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000202
Family Ankyrin repeat 0.0046
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr5P28260_001
Domain Number - Region: 288-316
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00072
Family CCCH zinc finger 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr5P28260_001
Sequence length 562
Comment pep:novel chromosome:MA1:5:28543013:28547861:-1 gene:GSMUA_Achr5G28260_001 transcript:GSMUA_Achr5T28260_001 description:"Putative Zinc finger CCCH domain-containing protein 66"
Sequence
MVDLLQLLLFVVVGGFEVAIHLCILLLDVGGREDMCGGHRKLSSLPNDPAAGCGAEAMET
SSEAAAVLLELAASDDLAAFRRAVEDDGRPLDAAASWYGRSPGRGMGYQLRTPLMIAALY
GSTAVMGYILSACPAEAVRHAYSDGATALHCAAAGGSAASLEAVKLLIGASADVVDALDA
GGSRPGDVIARQFSSTVAKSLEVILKATSCPRVSSPSREEQAKQAEKKEYPPDLTLPDIK
TGIYGTDEFRMYTFKIKPCSRAYSHDWTECPFVHPGENARRRDPRKYSYSCVPCPEFRKG
SCRNGDACEYAHGVFESWLHPAQYRTRLCKDEIGCNRRVCFFAHKPEELRTVNPTAASVA
GMQPGSPMSPSASSGIGSAAAWMNQTGGVVTPPALQLPSSRLKASLSARDLDFDLNWGTN
NLAAATTRAPDYTDLLGSMQSPAAIQMHQSQLLSGYAAAPPSLMSDWGSPDGKLDWGIQG
EELNKLRKSASFAFRSSQAAIGGVAPATGATNEPDLSWVQSLVKDGPAAPVGRPGMGKQQ
NRYQLNGGGDLFSPWAEEKIMA
Download sequence
Identical sequences M0T2F0
GSMUA_Achr5P28260_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]