SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr6P07280_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr6P07280_001
Domain Number 1 Region: 55-303
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.62e-45
Family Voltage-gated potassium channels 0.0035
Further Details:      
 
Domain Number 2 Region: 307-498
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.83e-38
Family cAMP-binding domain 0.006
Further Details:      
 
Domain Number 3 Region: 526-686
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.41e-32
Family Ankyrin repeat 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr6P07280_001
Sequence length 824
Comment pep:novel chromosome:MA1:6:4899622:4909419:1 gene:GSMUA_Achr6G07280_001 transcript:GSMUA_Achr6T07280_001 description:"Potassium channel AKT2/3"
Sequence
MKAHNSMTNGCRKHGDESSSESLSLSSLSKLVLPPLGMSSCSQNPNGSRWRIFLPMDSRY
RCWEAFMVALVAYSAWVYPFEIAFMHAAPKGGLFLTDNVIDAFFAADIVLTFFVAYIDSR
TQVLVCDPRKIATRYLSTWFIMDLTSTLPFEGLGYLITGRVKAGVSYSLLGTLRLWRLRK
VKRFFTRLEKDIRFSYFCIRCVRLLFVTFFLVHCAGCLYYLLADRYPHQGKTWIGAAVPN
FREANLWMRYIASIYWSISTMTTVGYGDLHAVNTREMIFNIFYMLCNLGLTAYLIGNMTN
LVVEGTRRTMEFRNSIQVASNFVCRNHLPPHLKEQILAYMCLRFKAETLNQQHLMDQLPK
ALCKSICQHLFLPTVKEAYLFKGVSRETLLLLVTKMKVEYIPPREDVIMQNEAPEDVYIV
VSGEVEIIYSDNEMEQVVGKFSTGDIFGEFTALSERPQSFIFRTRTLSQLLKLKQSTLKE
VLHAKQKDGIIIMKNFLKHQTEFKDISIDNLLGENGEFEETNKPCNLLTVAATGNSCFLD
KLLKAGMDPDIGDSKGRTPLHIAASKGYEDCVLVLINHACNINIQDMDGNTPLWDAITGK
HHNIFNILHRCACVSNPYTSADLLCLASKRNDLSTMRELLNHGLNIDSENHEGLTALQIA
SAENHEEMVTFLVMNGASIVKSNPNGSIERWMKKEILEEMIQQRDVGYPTMALEPYGAFK
KTEVLREQDNSLKLEANEHRPRISVFNGHPLLRNSHSETGKLISLPSTMEELRTIIGKKF
EVDARYKILTNEDAAEVDSIDVLRDNDKLFIVGEDELLKLDIKC
Download sequence
Identical sequences M0T4X7
GSMUA_Achr6P07280_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]