SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr6P09330_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr6P09330_001
Domain Number 1 Region: 1139-1218
Classification Level Classification E-value
Superfamily TAZ domain 2.35e-16
Family TAZ domain 0.0007
Further Details:      
 
Domain Number 2 Region: 935-1008
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000141
Family ZZ domain 0.012
Further Details:      
 
Domain Number 3 Region: 1055-1122
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000589
Family ZZ domain 0.0079
Further Details:      
 
Domain Number 4 Region: 208-289
Classification Level Classification E-value
Superfamily TAZ domain 0.0000000102
Family TAZ domain 0.0012
Further Details:      
 
Domain Number 5 Region: 589-629
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000195
Family PHD domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr6P09330_001
Sequence length 1260
Comment pep:novel chromosome:MA1:6:6253026:6263368:1 gene:GSMUA_Achr6G09330_001 transcript:GSMUA_Achr6T09330_001 description:"Putative Histone acetyltransferase HAC1"
Sequence
MGHVQVKDGAGAPEAFTDPSIYGDTRLMFDWKFSSLNVSSVPVSPFVSSIDSKIMKGRFI
GSNFELTDMISMQHPPPGSGSLLQSYLKAQVHDSQQGHLCQIKQKCMGSQPSLQGPHPPY
DPFVQHQFLQKDQYQQQEENKVGNQDFASSHSESFLNGPRLMNSQNLLDVVPIEPLAIHD
VIKHEQPPPMFEGIASDVDHLTTIPQRPTRFQAIHNVLFLYEHVRNCQDDGKGCILLQCM
NLKRNLHHILHCKDANCTKNCFKYKRLFDHYTECCKSLCSICGPVRMRLKEVSQRNFSNA
FTEPETTLPAVPRPDHKESAFKRAKTMHHFDQNGTHHVSLPVMNCSLLTDTGVSQLGQEV
SIPVDMKTDSPEPVEKQSVDSNFRDSGEIYDTKIEDTEVKIQEGFGVEPAELAQVVTHSE
QENLVQLEFLEADISSQCDITLAAAAKVSETKMDNPKRVVSLLDTFTAEMLREHIRSLEQ
HISKDKANTSESQGMEHLVDQNFCSLCGMEKLIFEAPPRYCSSCYKQINPKGVYYTMRSF
KSTKYGCGAKISFCGKCHGASGESIKVGGEDIRKSDLERRLNYAETDAETEWWVQCDKCK
AWQHQICALFNGKRKEALQAEYICPKCYLEELERGKCEPLPQSSILGASDLPKTILSDHI
EQWIFQRLKQEREERARILKRSVDEVPGAEGLIIRVVSSVDKKLEVNPNFREVFKEEMYP
SHFPYKSKVILLFQKIEGADVCLFGMYVQEYGLDCAFPNQRYVCISYIDSVKYFRPEIKA
ATGEALRTFVYHEILIGYLNYCKKCGFTSCYIWACPSLRQDYYILYCHPKTQKTPKSDKL
REWYQTMIRKAMKEKVILEHTNLYDNFFVHTSECKTKVTAARLPYFDNDFWPGKADILLQ
EDKNESQRKGTKAVIERALRAAKRDASAGNPKDILLMHQLGEIIRPIKEDFIMIHLQHTC
KYCYLPIVSGKQWVCNVCKNFHLCEWCYDKGQNLDMKDRHPVTSKEKHSFRLVESDGLAD
TDDKDKMMQSKLFDMRTGFLGFCQSEQYQFDTLRRAKHSTMMILDHLHDPTAITTASSCA
ICHCNMDNDQNWHCMICQDYHLCADCYHKKGASYHKHQLVSHATMADRTLQPKKQRNGKI
NIQVFMILDALLHAPKCCAPQCAYTCCLQVKKLFLHSRKCKVRAHGGCISCKKIWLLLRW
HVRVCQEFDCHVPRCKDLKDFTRKMRHSRSKESSSKVVSESSISPDQQLPSIFASLEGPL
Download sequence
Identical sequences M0T5I2
GSMUA_Achr6P09330_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]