SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr6P10390_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr6P10390_001
Domain Number 1 Region: 480-566
Classification Level Classification E-value
Superfamily E set domains 7.62e-18
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0012
Further Details:      
 
Domain Number 2 Region: 672-777
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.24e-16
Family Ankyrin repeat 0.0014
Further Details:      
 
Domain Number 3 Region: 886-941
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000109
Family Motor proteins 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr6P10390_001
Sequence length 1065
Comment pep:novel chromosome:MA1:6:6947189:6963022:-1 gene:GSMUA_Achr6G10390_001 transcript:GSMUA_Achr6T10390_001 description:"Putative Calmodulin-binding transcription activator 3"
Sequence
MAETRRFSLTPQLDIEQILLEAQHRWLRPAEICEILRNYQKFRIAPEPPNKPPSGSLFLF
DRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGSIDVLHCYYAHGEENENFQRRSYWML
EEDFMHIVLVHYLEVKVAINLSSHGHKPSYSRTRDVEEVPRVNHMDSPVCSNSITSQSQL
PSQGTDVDSPNSAHTSEYEDAESDNHPTSSRYYPFLRMQQYDAGQMMSVQLLDPYVSDPS
VDSDFQGTHDAEPKSDFYSVTQEDISRVFDETGLGLSFRGSKTQYDLTSWDEVLEHCATS
FQMPSFQSSVGFTEPPVVENNNKLESSILGDLYDGNHSTRPDGSGVLDKPAWQMSIYWYH
HQIRYKLSNPDSESAVTSNINVESGTSVSESVDCPSIVKQPSLDLSIIEGEGLKKYDSFT
RWMSKELGEVDDSHMKSNSGVYWSAVGSDNVVEDSSISNHEHLDAYIMSPSLSKDQLFSI
IDFSPNWAYTGLETKVLITGTFLKKKEDLGKCRWSCMFGEVEVPAEVVGDGILRCHAPPH
KSGRVPFYVTCSNRLACSEVREFEFRGSNAHPVENIGSCIYNTNEMLLHIRLDKLLSLGP
IDYQKIDPEIFRRKAHVRSKISSIMMDAADECSSLLKLAEREGCTADYVKDQLLETLLRE
KLVTWLLHKVAEDGKGPSMWDTEGQGVIHLSAALDYYWAIKPIVTAGVNINFRDVHGWTA
LHWAAFCGREWTVGTLIAMGAAPGLLTDPSPEFPSGRTPADLASANGHKGIAGFLAESSL
TSHLLALTIDTKESDLPEIASLTGIEDDAERSALEVAEGDMQAGLSLKDTLSAVRNASQA
AARIYQVFRVQSFHRKKIVEYGDDKSGISDEHALSLISIKSHKSGHYDTPLHAAAIRIQN
KFRGWKGRKEFLIIRQRIVKIQAHVRGHQVRKRYRKIVWSVGIVEKAILRWRRKGSGLRG
FRSEGLLEGTTMQCQPKKEDDYDFLQEGRRQTEARMQKALARVKSMVQYPEARDQYRRLL
AVVTDFQESKAMEESVDNESEENADGDFMVELEEFLEGDTLMPSA
Download sequence
Identical sequences M0T5T8
GSMUA_Achr6P10390_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]