SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr6P10820_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr6P10820_001
Domain Number 1 Region: 180-449
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.69e-80
Family Protein kinases, catalytic subunit 0.0000249
Further Details:      
 
Domain Number 2 Region: 62-157
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.21e-19
Family Ankyrin repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr6P10820_001
Sequence length 459
Comment pep:novel chromosome:MA1:6:7198869:7208021:-1 gene:GSMUA_Achr6G10820_001 transcript:GSMUA_Achr6T10820_001 description:"Putative Serine/threonine-protein kinase TNNI3K"
Sequence
MDRNGIGGSSEAMSGDSKEGYATGGGEGASSGSSSGASSPPRAGPVGGKQRDKARVSQTS
LILWHTHQNDVAAVRKLLQEDRGLVNARDYDSRTPLHVAALHGWIDVAKCLLDHGADVNA
QDRWKNTPLADAEGAKQPSMIELLKSYGGSSYGQNGSHFEPKPVPPPLPSKCDWEIDPSE
LDFSTAAIIGKGSFGEIIKAYWRGTPVAVKRILPSLSDDRLVIQDFRHEVNLLVKLRHPN
IVQFLGAVTERKPLMLVTEYLRGGDLHQHLKEKGPLSTVTAINFALDIARGMAYLHNEPN
VIIHRDLKPRNVLLVNSNADHLKVGDFGLSKLIRAQNAHDVYKMTGETGSYRYMAPEVFK
HRKYDKKVDVFSFAMILYEMLEGEPPFSNHEPYEAAKLVAGGNRPSFRAKGYVQELRDLT
DECWAADMNRRPSFLVILKRLEKIKENVSQENHWSIFNQ
Download sequence
Identical sequences M0T5Y1
GSMUA_Achr6P10820_001 XP_009404093.1.42102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]