SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr6P10860_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr6P10860_001
Domain Number 1 Region: 1239-1512
Classification Level Classification E-value
Superfamily SAICAR synthase-like 2.35e-79
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.00034
Further Details:      
 
Domain Number 2 Region: 452-590
Classification Level Classification E-value
Superfamily GroEL apical domain-like 2.62e-27
Family Group II chaperonin (CCT, TRIC), apical domain 0.0014
Further Details:      
 
Domain Number 3 Region: 32-113
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.76e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr6P10860_001
Sequence length 1546
Comment pep:novel chromosome:MA1:6:7235589:7247292:-1 gene:GSMUA_Achr6G10860_001 transcript:GSMUA_Achr6T10860_001 description:"1-phosphatidylinositol-4-phosphate 5-kinase/ zinc ion binding protein, putative, expressed"
Sequence
MENSDNAFSELFSIVKSWIPRRSEPPNVSRNFWMPDHSCRVCYECDAQFTIFNRRHHCRH
CGRIFCGKCTANFIPATSDNLRSTKEVGERERIRVCNFCFKQWDQRISSTDNAFQQYISP
ALSSTSIVSTKSSGTINSNFNVESYSSGPYHLIPYGPAPNPCQSVLLEPCSDKPDLHVSA
RSIDAVEIGSHRFGYVMNSINEVLLWVCRSDDDDYEYGGLHDSETQHFQHYDDYGGQDEF
NGVDQDCYSNKMIPAEVDINLENICSPAHNTQLHATVDADKMDEENEPDCSYECNASPSI
YEIENADAEPVDFENNGLLWLPPDPEDEEDERESILIDDDEDEDSPTGEWNYDHSSNGFG
SGDFRTRDRSIEEHKKAMKNIVDGHFKVLIAQLLQVENLSAGEDDRGSWLDIVTFLSWEA
ANFLKPDTSNDGGMDPGGYVKVKCLACGHRSESKVVRGVVCKKNVAHRRMKSKIEKPRFL
ILGGALEYQRVTNTLSSFDTLLQQEMDHLKMAVAKIAAHQPNVLLVEKSVSLPSIDHLSS
PMLGHCDLFHVEKYHEDHTTAAQGGKKMLKNLMFFEGCPKPLGCTVLLKGASVDELKKVK
PVVQYGVFAAYHLALETSFLADEGAFLPELPLKTPITVALPDKPSSIDRSISLVPGFPTA
GEPHGSVSVQRPNTTYPVTTSIESRKMVLEASPSSSGASLPSFSTLGNVSNYSPQSRTTK
DKKNCAAIPKDAQTESKFALSPSDHLSILVSLSTRCVWKGTVCERSQLFRIKYYGNFDKP
LGRFLRDHLFDENYRCRSCDMPSEAHVHSTRRVVMSDAAWGLSFGKFLELSFSNHAAASR
VASCGHSLHRDCLRFYGFGRMVACFRYASINVHSVYLPPPKVDFNYQHQEWISKEANEVC
SNRKTEFFSLSLAENLFREIHSDLCQFKETMIQNGSMEVPEFRHHIVELQDFLQTEKAEF
EDVLHKVLKKEVRKGEPVIDILEVNKLRRQLIFHSYLWDQRLLFAAELDNYSQCSNAAPV
EFKTDELFEQGTHTANNPEGLFGHHDSDELGQKIRDVEMDSMQEKQNQTSLYTSISATES
SILLESGLVGRRTLSDGQFPVLTNLSDTFDARWIGDKRAGADITQSFTSILLSKLGDSAE
DFSARIGIPFVNIYRTINKNWGNSPRFSDLNEYSSVFRIFLRELERQGGARFLLPVGLND
TVIPIYDDEPTSIISFALVSPEYHSFDETFSDPFKSFGSTEDNILSLSVKYTVTCYYAKC
FDALRRACCPSELDFIRSLSRCKKWGAQGGKSNVFFAKSLDDRFIVKQVTKTELESFIKF
APEYFKYYSESIATGSPTSLAKILGIYQVTSKNLKGGKDIRMDVLVMENLLFRRNITRLY
DLKGSSRSRYNPDSSGNNKVLLDQNLIEAMPTSPIFVGNKAKRLLERAVWNDTSFLASID
VMDYSLLVGVDEEKHELVLGIIDFMRQYTWDKHLETWVKASGILGGPKNVSPTVISPKQY
KKRFRKAMSAYFLVVPEQWSPPTGIPNKPDAEISQENQQGATTEGN
Download sequence
Identical sequences M0T5Y5
GSMUA_Achr6P10860_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]