SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr6P12560_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr6P12560_001
Domain Number 1 Region: 252-358
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000995
Family Ankyrin repeat 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr6P12560_001
Sequence length 541
Comment pep:novel chromosome:MA1:6:8378026:8381888:-1 gene:GSMUA_Achr6G12560_001 transcript:GSMUA_Achr6T12560_001 description:"F-box/ankyrin repeat protein SKIP35"
Sequence
MESEIRRKDKNKQEKKLSRKDRIELGRLFQGALSSQDLELAENFILLADPQTLNDMLCIT
LDSIWFLTTKQELNGVTGMIKKIVANGANDFTRATLRTSFLASCVSACQSKTMSLADTVG
IMAQRLHERLRECHGDEVLKAEAGVKVQKFTDWALKCIGIHSRSRKDRDRRSYSTIFEVQ
LQLSAFKSFLDLAGNSLTGKDFTEAFDAACFPLTLFSSSFDPGWAFGISATVIQGLLGML
VEGGADNVNQCFLEASRFGSTELVRILLQIAQRNSLDVDVELALGFASHHCKIGTMECLV
EEGNAGAFLGPLLRAAERGCMQVVQWFVDRGCRDMELCIALTASVASSQVGIAAYLLPRI
PEHVLAALSIEILKAAAERSSGSLAGVEFLLRNNFLGDPVATYAVADSIAESSDEAVAPD
LRAFLKEHWSEAAFAEGLNYGQNHFVNFMRILRRGGSPICLRDLPPSLVTAIAYLSLYRE
CRKAGGLLLPQKLRGQLVEAASKVAGRPVDKNSQAGDLMAVLEHHLPTFFLQSPTTTSPP
L
Download sequence
Identical sequences M0T6F4
GSMUA_Achr6P12560_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]