SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr6P15530_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr6P15530_001
Domain Number 1 Region: 1-52
Classification Level Classification E-value
Superfamily SAP domain 0.0000000000000183
Family SAP domain 0.006
Further Details:      
 
Domain Number 2 Region: 103-170
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000102
Family PHD domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr6P15530_001
Sequence length 870
Comment pep:novel chromosome:MA1:6:10347443:10364676:1 gene:GSMUA_Achr6G15530_001 transcript:GSMUA_Achr6T15530_001 description:"E3 SUMO-protein ligase SIZ1"
Sequence
MDFVASCRDKLANFRIKELKDVLTQLGLAKQGKKQDLMDRILALVLDEQVPEPQVWGRRN
FVGKGGVAKIIDDTYRKMQIPGATDLASKSYSRTEFNHMKPKEVDSYKSEMKIRCPCGKS
SNSESMIQCEDSGCRVWQHIVCVIIPEKSMEGASPEVPSHFYCEICRINRADPFWVTMGH
LLHPVKFLSAGITADGTITVHNVERTFQLSRSDKELLTRPEYDLQAWCLLLNDKVPFRMQ
WPQHTELKVNGMEENLVARPGSQLLGINGRDDGPMITTYSKEGMNKIVLSRCDSRIFCFG
IRLAKRRTVPQVLSLVPKEEEGECFQDALARVCRCIGGGAATENADSDSDIEVVADSVTV
NLRCPMSGSRIRIAGRFKPCVHMGCFDLETFVELNRRSRKWQCPICLKNYSLENIIVDPY
FNRITSMLQNCGEDVTEIDVKPDGSWRVKNELESTDHSRSHLPDGTLYAITDAEVKPYMG
NLRYMKQKSPSERHFSLNSGMKSNPKQRPKDKRLPSFESPSLGKLENLCEGIINMSSSAT
GSYRDGEDPSVNQEVGGPFYLSLNNGHESDSLSLNLDPTYSIENITPAPFEDPNVIFLSD
SDDTLISPETAYGIHPSGNNTIPFPNHPGVSEKYSENNGPDTSGTSFLGLYNNTDVFETW
PLHACPQSGPGFQLFGTEVPDVLADSHSSLGCAPISGYGLTTNHGVEVTAQIQDLFKCHS
GTGMLGSLGDNPLAVANDDPSLQIFLPSQPVGVALQDDLINGTDIGNGINSDDWTSLRLA
AGGTHGDSTPSNGLTSRQQVTPKETQMDLLNDDASLLLSMNSNKANKANFKTQKSDSSPG
QPRSIRPREEKVLLINNLPRMLSSYKNSII
Download sequence
Identical sequences M0T7A1
GSMUA_Achr6P15530_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]