SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr6P21630_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GSMUA_Achr6P21630_001
Domain Number - Region: 9-79
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.046
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr6P21630_001
Sequence length 156
Comment pep:novel chromosome:MA1:6:18124914:18125384:1 gene:GSMUA_Achr6G21630_001 transcript:GSMUA_Achr6T21630_001 description:"Putative Predicted protein"
Sequence
MHAYGLVLEQKDQELRRSYSDMVAESEKKLMMDAETRSNEVESVKCECCGMSQDCTRIYI
ERIKAFFCGHWVCGLCSEAVKEEMRLRPAVAMEEAMRAHMALCKGFNRSRLNPQLSLASA
MRDIARKSLQHRTSDVFFASEARRTTSCKFRRASFQ
Download sequence
Identical sequences M0T911
GSMUA_Achr6P21630_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]