SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr6P25240_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr6P25240_001
Domain Number 1 Region: 159-290
Classification Level Classification E-value
Superfamily SET domain 5.72e-21
Family Histone lysine methyltransferases 0.014
Further Details:      
 
Domain Number 2 Region: 1-38
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000153
Family PHD domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr6P25240_001
Sequence length 302
Comment pep:novel chromosome:MA1:6:26321011:26324003:-1 gene:GSMUA_Achr6G25240_001 transcript:GSMUA_Achr6T25240_001 description:"Histone-lysine N-methyltransferase ATXR6"
Sequence
MILCDRCDRGYHLYCLRPIAVRVPSGPWFCPSCGGERQFRRFPMMQTKIIDFFRIQGTEE
KSGHSQGDCTYGRKRKRSSLVMYKKRRRILPFTPTENSARRLEQMSSLATALIAMHMKFS
NELTYMPRMAPKSANQANLEKDGMQVLPKEDKETLELCRSMYKRGECPPLLVVFDPLEGF
TVQADGPIKDMTLVTEYTGDVDYLKNREHDDCDSMMTLLLAKDPSDSLVVCPDKRGNIAR
FINGINNHSRDGRKKENLKCVRYDVNGECRVLLVACRDICSGERLYYDYNGYEQEYPTHN
FV
Download sequence
Identical sequences M0TA20
GSMUA_Achr6P25240_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]