SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr6P25250_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GSMUA_Achr6P25250_001
Domain Number - Region: 6-38
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00125
Family PHD domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr6P25250_001
Sequence length 633
Comment pep:novel chromosome:MA1:6:26328818:26331043:-1 gene:GSMUA_Achr6G25250_001 transcript:GSMUA_Achr6T25250_001 description:"Hypothetical protein"
Sequence
MCKSSAEHRYCLDILPSYHEEVSWSCDLCKPRPSKVELEILHRSTRKLKCKKIRKRCQIT
IAAPQFAPPQKQPHYKKSPATVHGQASIWKSPASLLQKEVDDLSQSFRVQLKDKKLKKRR
RLVIPVDDQLVEDIQTNNVEAKYENTLTAPKHDSPQKRQEYVPHSHVHMENNGDSTVNGK
WNRPSDSLLQKKVVDLSQSFGIQFERKNLKRRRMILPEDDQLDGDVLNNSAVNERLLEAR
YENTVIASKVASPENPHQYITCTHSVQNGTCAGATVKSNRSTNSLSQKEVDDLFQSIRMQ
SEEKNLRMRRTRLILLEGEQLGQEAQTNNAVNKRLTEVRYDKTVTAIKAASPGKPHQYVY
KENHAGPSEDGISNRSTDNLLQKKVVDPFKSFRMQLERKNLRMQSRRLMLLEDDQLDEDV
QINNEANEGHLKAEKSVNVSSELSDGRFLKKMRGLPNECLLDEEVHINSTGQNSPISGPL
QLHPTLQVEEHTPGRKLICSLASSYEPYNLPAQPIRNHIWRGHFHVCNKELGPFTAHISS
KACEKVWNIAKKLPAVLQMTKLSRLDSWPKSFKTSPPNDESIALYFFAQDARLNMMRQSC
LHSPRLYCRKVIVVSLPSSMMVFVNLKEMLYLS
Download sequence
Identical sequences M0TA21
GSMUA_Achr6P25250_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]