SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr6P25440_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr6P25440_001
Domain Number 1 Region: 603-662
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000082
Family PHD domain 0.0018
Further Details:      
 
Domain Number 2 Region: 788-890
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000000000854
Family N-acetyl transferase, NAT 0.017
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr6P25440_001
Domain Number - Region: 656-707
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00509
Family PHD domain 0.02
Further Details:      
 
Domain Number - Region: 40-75
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0288
Family Methyl-CpG-binding domain, MBD 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr6P25440_001
Sequence length 947
Comment pep:novel chromosome:MA1:6:26519890:26529418:1 gene:GSMUA_Achr6G25440_001 transcript:GSMUA_Achr6T25440_001 description:"Putative Whole genome shotgun sequence of line PN40024, scaffold_14.assembly12x (Fragment)"
Sequence
MNIKKTLLNTPNSKTVDVGGNRALPTDLSTSLRSHAHHLLMDAGWKICIHSRKDGRKFDL
IYYPPAEGAQLYSLSRAWISCGVELSANTSNIREEESGRVWTDINAFSGDLADVLEFIKM
EIRHPENSLSLLQRWVLLDPFVAVVCINKKISALRKGTAVKAVNSMTTVLGGTESLGLLR
SDVNGVLHNSRSLCSSERSLLSDIVSDGKSSALGLVHPKEKRSHQDTDSLSKKAQLGRVD
TQAFNAKEVTEQHRSSCSKGGHRVESSMEYPVAHENEVIEERKRTSGSYGNLSTANQSSQ
HQMNEQHNVLLYPPGGTLFFTMDDNQREPLLAHLVTTNANGSTNIHQQVQPLVYQANLVT
GVFSNSGCLKESSLEKKKSNSMLYNISISQEPHRESCLHTSVILLDGKLPFSGNNLEVSK
VKRPEIFKENKQKQQSKGHANDDDLFIATIVKRKGCRSASREIISKVGSLDASEKLRSRN
GDHKLFQNNAGEGGKISNVKRSIGRRTVLCRLIEMGVISVRNTFQYCELKDSTVVKDGRV
TKNGILCRCCKKFFSISEFKLHAGDMLQKPCLNLFLRSGKSYVLCQLQAWSLEYKTRKDA
IPVMDDEETEQNDDTCGHCGDGGELICCDNCPSSYHQACLLSKELPEDRWYCPNCICDVC
GVVVNIMEAPSAMATLECSQCQHRYHDKCIKEKVTRNEEVASRTWFCGVDCQEVYLGLRS
LVGVMNCVGDGFSSTVLRCNHGDKTLQSAEEIAVVAECNMKLAIALSIMEECFLPMVDLK
TGIDMIPHILYNWGSKLPRLNYKGFYTAVLEKNDELISVASIRIHSVKVAEMPLIATRSE
HRRRGMCRRLLAAIEEMLKSLKVEMLVLSAIPTLVETWTSVFGFKQLEDTEKWLQNIDLM
SFPGTVLLKKSLYDATTKTSATNDEVPTRPSSSGMQGMMKDGNTQER
Download sequence
Identical sequences M0TA40
GSMUA_Achr6P25440_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]