SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr6P26030_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr6P26030_001
Domain Number 1 Region: 171-420
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.23e-66
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 48-140
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.29e-23
Family Ankyrin repeat 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr6P26030_001
Sequence length 464
Comment pep:novel chromosome:MA1:6:26943418:26954232:1 gene:GSMUA_Achr6G26030_001 transcript:GSMUA_Achr6T26030_001 description:"serine/threonine protein kinase, putative, expressed"
Sequence
MEAKSTGRFTLGKQSSLAPDRDDGELQALRSGDLDGLQVPEEVDANIRLMYLANEGDLAG
IEETLASGVDVNFRDIDDRTALHVAACQGFADVVQLLLDSGAQVDPEDRWGSTPLADAVH
YKNHEVIKLFEKHGAKLRVTPMRVENAREVPEYEIDPSELDFTNSVNITKGTFIIAKWRG
IQVAVKKFSDDVMTDEDKLRAFRDELALLQQIRHPNVVQFLGAVTQSSPMMIVTEYLRKG
DLRAYLNRKRTLRPSSAVLFALDIARGMNYLHEHKPEAIIHRDLEPSNILRDDSGHLKVA
DFGVSKLLKVAKTVKEERPLTCLDTACRYVAPEVFLNEEYDTKVDVFSFALILQEMIEGC
PPFSYKQDNEVPKAYVSKQRPPFRAPPKQYGHGLKELIEHCWSENPADRPTFREIIDRLS
KIQNHIAQKRRWKVTPLKCFQNFEAIWKKDGGSTRSSRSSTTNL
Download sequence
Identical sequences M0TA98
XP_009406155.1.42102 GSMUA_Achr6P26030_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]