SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr6P27450_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr6P27450_001
Domain Number 1 Region: 10-66
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000332
Family PHD domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr6P27450_001
Sequence length 370
Comment pep:novel chromosome:MA1:6:27965556:27970367:-1 gene:GSMUA_Achr6G27450_001 transcript:GSMUA_Achr6T27450_001 description:"Hypothetical protein"
Sequence
MANAEKKAEKTKICDICGDSGFMEDIVTCHCCKRASEHIYCMQVLQFRVPDVWYCNGCLS
KAHGVHKGKMQDTRTESDSFKICTFDSKRAKSPTKASTHLNDDPTPEEINDGRKQQNRRH
PMHSSFSNVSVKTIENAKVKFITLEEVALNYGATAYCKQGNSGVSCRRSVCPFNSRKSFT
SISRSCRLTSTRVPRQPNEATVDTDTDLSLGKAIIVREDIINDKEGNMQKNKVSDYNSSL
KSIVPAASNISSDASKHIDDRTKNRTKCKALGETSATLTEEKHMDRSIVASDYFQLKHIQ
EKEAKCVDVGVQPTRDRNKKIRTYDTSGGIVCSAAQCKRLASKENDLPLTLLINPNEKLL
NYPAPGTCWK
Download sequence
Identical sequences M0TAP0
GSMUA_Achr6P27450_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]