SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr6P29360_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr6P29360_001
Domain Number 1 Region: 95-163
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000264
Family Ankyrin repeat 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr6P29360_001
Sequence length 173
Comment pep:novel chromosome:MA1:6:29599930:29602300:-1 gene:GSMUA_Achr6G29360_001 transcript:GSMUA_Achr6T29360_001 description:"expressed protein"
Sequence
MASIPCNFYFQIPSPSSSSAKPSSSFLSLTRRLGWVKPSKMRSKVGPETNGSRTTCWFRF
GNRGVDAEGAGIYGSQTRDDFDRDDVEQYFNYMGMLAVEGSYDKMESLLSQNIHPVDILL
MLAASEGDKPKIEELLRAGAKYDVKDADGRTALDRAVSEEIKELILGYPVKTA
Download sequence
Identical sequences M0TB81
GSMUA_Achr6P29360_001 XP_009406499.1.42102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]