SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr6P29570_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr6P29570_001
Domain Number 1 Region: 728-788,833-999
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.26e-54
Family Tandem AAA-ATPase domain 0.00047
Further Details:      
 
Domain Number 2 Region: 631-799
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.62e-40
Family Tandem AAA-ATPase domain 0.00029
Further Details:      
 
Domain Number 3 Region: 69-122
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000014
Family PHD domain 0.0023
Further Details:      
 
Domain Number 4 Region: 517-577
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000000291
Family Chromo domain 0.0072
Further Details:      
 
Domain Number 5 Region: 583-627
Classification Level Classification E-value
Superfamily Chromo domain-like 0.000000000174
Family Chromo domain 0.0065
Further Details:      
 
Domain Number 6 Region: 1576-1628
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000555
Family DNA-binding domain of telomeric protein 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr6P29570_001
Sequence length 2142
Comment pep:novel chromosome:MA1:6:29777037:29802183:-1 gene:GSMUA_Achr6G29570_001 transcript:GSMUA_Achr6T29570_001 description:"CHR4/MI-2-LIKE, putative, expressed"
Sequence
MREESSSRDNMIDRNWLLKRKRKRITSGLGLSNGKESTSRSSESLLNNAAKRKKGDIHVS
RLARKIKGQDGHYFECVVCDLGGNLLCCDSCPRTYHLECLTPPLKRIPSGKWHCRNCSEQ
KANIKTSDNSEPYLRRARMKSMFGKPTILYKQPVHDKATLPERNSVPRTNNGKATFSRRT
PNQKSDSSRYDKSVSPKSSHLCEGGPQDGILAATDNKTKKSDSSFRRKTSSHEKSRKKKQ
KPSMTDKKKKPIAKKGKDASTAVSNEPSMETCLSTGGSLQNCKSLDQQNSASKEEASSSA
GEEQYEISTEKASRSSQELDERSMQAHKITKHHGNHWDGVQQVDRILGCRLQASTKMSSQ
TIRSPTSSELADSENNPGSPASRQPPYGLNGPRNNDKLLTECQNQCEVEIKDTKRVLTEA
YNDKSCESKGSLNNIPTSECLQDEHITKENFVVLKDSPLDKANIALEVCMENSKDSDLIS
AHKQSNSYTETGPSQLAVSCVSNGDDGSVLDTQPSNNDKSRITVEMVQDSGNENNDDIIY
EFLVKWVGQSNTHNTWVPESQLKILAKRKLENYKAKYGTAIINICEEQWKIPQRVISLRT
CKDGINEALVKWCGLPYDECTWERLDEPVMKESAHRQPNVLKGGLLFPHQLEALNWLRKC
WFKNKNVILADEMGLGKTISACAFISSLYFEFKAKLPSLILVPLSTMPNWLAEFALWAPR
LNVLSKSYKFNVLIVDEGHRLKNSSSKLFGLLNTFSFRHRVLLTGTPLQNNIGELYNLLN
FLQPVAFPSLAAFEEKLKKDAMQNIPPKTERIIPVELTSIQAEYYRAMLTKNYQILRNIG
KAKLTLLHSMLKILHKEGHRVLIFSQMSKLLDILEDYLTIEFGPKTYERVDGSVPVADRQ
AAIARFNQDKTRFVFLLSTRSCGLGINLATADTVIIYDSDFNPHADIQAMNRAHRIGQSK
RLLVYRLVVRASVEERILHLAKKKLMLDQLFVNKSESQKEVEDILRWGAGELFSDSDAVN
GQDAKEAPTSKLDAGCTKIVWDEGAILKLLDRSDLQSVSESTDVDLENNMLGSVKSVDWN
DDTNEEPDGSQLLPGVAVDGCEKISEAKEDTAVGGSEENEWDRLLRVRSYSKYDNQTLYL
YVVHRWEKYQLEEEAVLGRGKRLRKAVSYKESFASIPSETISESGNEEEEPEHEYTHAGR
ALKEKFARLRARQKERIAQRQTADFSHSTDRTELLTQSMVQSVHEAEGLEKKIQDDNNEQ
VVTIDQEDDTSTQPLDDKRTESPARLGKFLKHGYKRFHSDHLDLSVRPPGSLSADFFLPR
NQLQSTNNAVSLPSNNLLPVLGLCAPNASQAGSSSRNFRSPLRLSTSSNGQRRISSRNVE
CPLPAASCSRPPNDMNIELKEKSASTSILPEASGDSLHHKLKNMIPDGYFPFYPPASTSG
RPPLDIFETSSSSFTSFQEKLGLPNLTFDVNMAPKFSIPPKNLMKPHSDLLPSLSLTMEY
INSSFQELPNMPVLPNFRQQLSDSLKQKQQMTELKSRLDIGPMPGTRSSLPENHQKVLDN
IMMRTQSATNKLFKKRLKADAWSEDELDALWIGVRRHGRGNWDAMLRDPKLRFSKYRTIE
DLFLRWTEEQQKIIDTPAFSAPKSSKPLSFPEISDGMMTRALLGGQLPGLGSAWPKSFSD
LTDIQLGCGDFKSSFSCTDPFSHNSRIDENCPQVAAWKNDRPRSGFHGGFYPGVSLPFDM
PCSDNLVTSLSMNHPSSSALQQNEDENCAMKNFPLPGVSEKLQNLLHDSISKVHSNESNV
GMTLDPHKQQTFLDSSSNNSIAFGSSNTNKLPHWLREAVNIPPSRPPEPELCSTLPPTVS
AIAQSVRLLYGEEKTFPPFAIPDLPPIQPQDPRKSLKRKRKLDRLQQLTPDIDGFIEKFD
HSSPGTIPPVSQIMESAPDLGRSDLNEDFTSQNLNLNSPTLSSFATQEKSSGSALAACPE
VLEQVKSCMSCGPCGLSVTEMPGPSCQRTEMSKSKDLEIFKHDRKGLNEDLEDGHGKHKT
ARNSLLGCWDKMLSTEQTSQADNRDSSKTQSDTSRPNQMNLKEMSSEETVSDNNKSEHEH
RENGLEMSKLLIRGYEGRFVSCKSSFYLCMGENGDDKSWRKH
Download sequence
Identical sequences M0TBA2
GSMUA_Achr6P29570_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]