SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr6P29980_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr6P29980_001
Domain Number 1 Region: 759-855
Classification Level Classification E-value
Superfamily BRCT domain 1.6e-21
Family BRCT domain 0.0029
Further Details:      
 
Domain Number 2 Region: 7-77
Classification Level Classification E-value
Superfamily RING/U-box 9.28e-18
Family RING finger domain, C3HC4 0.0064
Further Details:      
 
Domain Number 3 Region: 870-979
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000157
Family BRCT domain 0.044
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr6P29980_001
Domain Number - Region: 657-707
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0364
Family PHD domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr6P29980_001
Sequence length 980
Comment pep:novel chromosome:MA1:6:30109305:30114262:1 gene:GSMUA_Achr6G29980_001 transcript:GSMUA_Achr6T29980_001 description:"ATBARD1/BARD1, putative, expressed"
Sequence
MADLANLEKMGTELKCPICWSLLNSAVSLSCNHVFCNSCIAESMKKSASDCPVCKVPFRR
REVRAAPHMDNLVSIFKSMEDMAGTNIFSTQIGPQNLGEFFLHIFASNMILDKSKRKECS
QIENAKEKTKAGRSPHYKPKTPSFPAKKRIHVTPYSASETPLRPEKIHKLEDARIELTGD
TELNDNKKLFADDTEDPSLSPFFWLRGNDDIDESPQKPSDQQIMETPSPQSAPCFSDMKD
SDDEKPTLPTPTNKLNVAADFDSEMFEWSQRAYSPELFSTPQRTQTVERHRLLKIPEKEC
QGNIDAVVHYEDANVGTASIGKKILHKRRRNSNTLLKSRKSLIKEDQDFRSHDVNGEVPC
NSEDVVDRSYPKPKRTSVKGCQKSATSYQTNCSMSLRSLKKQFNNAAIEASEQSPDISVK
AKYSSVIKGSGGTAKRSDRKIKGTDSELQRKHLKRSNIDVQAEVPEAIVSLTNDAEIQDE
SNIKFPELPASTLQQRKTEKLSSEILDKSGKHIHQKKRIAKNQASELKVTSAVKVPATPM
GTAACESNKTSSNALKEYKLSLAVKNTSKNRIQSTENIIMRKCQESHSPIRCAFCHSSTD
TEDSGEMMHYFNGKPVAADFNGGRNVIHSHKHCTEWAPDVYFEDDMAINLTAEVSRSRRI
KCSCCGANGAALGCYERSCRKSFHFTCAKLMQECKWDTQNFVMLCPLHSSMELPNEVSEP
QRQSRKKSTTKGSSQASSINTCDHPSQKWKWPSGSPCKWMICCSALSAAEKEAVSKFAKV
TGVPISNTWNPEITHIIASTDHNGAYRRTLKILKGIIDGKWILKVDWINACMDAMEPIDE
EKFEVTVDIHGISDGPRLGRLRAINKQPKFFNGFKFYFSGDYTPSYKGYLQDLVIAAGGS
VLQRKPISRDNKRLLGDASTWRTLIVFSIEHPEKHNCNSDTVIYHRRSEAQALADASGGT
LAGSTWIIDSIAACKLQPLT
Download sequence
Identical sequences M0TBE3
GSMUA_Achr6P29980_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]