SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr6P30890_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr6P30890_001
Domain Number 1 Region: 247-457
Classification Level Classification E-value
Superfamily SET domain 1.57e-58
Family Histone lysine methyltransferases 0.0017
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr6P30890_001
Domain Number - Region: 120-168
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00192
Family PHD domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr6P30890_001
Sequence length 537
Comment pep:novel chromosome:MA1:6:30829801:30848014:1 gene:GSMUA_Achr6G30890_001 transcript:GSMUA_Achr6T30890_001 description:"Histone-lysine N-methyltransferase ASHR3"
Sequence
MLALPIISRPRRPPFFPPLAPRSFHTPLSLSLSNKEKTKTIIKETRRGMKNPKILDAGDA
GLDRKCSRPFKQERKTGKKAADGKASLADHVSAWREKKMAAGVPDRECFLPFLTNAPRMV
DCHMCNRCIYPGEELRCSVLGCQEAYHLTCAKKLIGPSTSKPFKCPQHGCFVCKQKAYWR
CVRCTMAAHTKCAPWPANVIYFKNRPGRAICWRHSSDWRLEKKEAFVRLPLPYVDEEFKM
GTILKDVVENKTEPAPYVHIRRNVYLIKKKRDGAETGVGCSNCGSNSTCKENCECRGLSV
SCSKACRCSDMCRNRPFRKEKTIKVVKTEYCGWGVVALEVMEKGDFVIEYIGEVIDDALC
EQRLWDMKHRGDQNFYMCEIHKDFTIDATFKGNASRFLNHNCDPNCKLEKWQVDGETRVG
VFALRSVDIGEPLTYDYRFVHFGPMVKCQCGASKCQGYLGSKRKLNQMPSSWGSLGSKIW
HPCLLCCFFVFNLCPTFICFSLTAIASHLTYCCCSICCYCIQYDLLYEIDIKQVIGV
Download sequence
Identical sequences M0TBN4
GSMUA_Achr6P30890_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]