SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr6P32880_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr6P32880_001
Domain Number 1 Region: 680-739
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000288
Family PHD domain 0.0027
Further Details:      
 
Domain Number 2 Region: 829-949
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000827
Family N-acetyl transferase, NAT 0.016
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr6P32880_001
Domain Number - Region: 740-795
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000226
Family PHD domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr6P32880_001
Sequence length 1060
Comment pep:novel chromosome:MA1:6:32087365:32100950:-1 gene:GSMUA_Achr6G32880_001 transcript:GSMUA_Achr6T32880_001 description:"Putative uncharacterized protein Sb01g038485 (Fragment)"
Sequence
MAIDDEPTRKRRRKKLMTGEAVEVGHFHEGLQSWHLAVVIECGEFFRVVEHANRLSGDRI
SEPEEVIPVSDAIEGTFSTATESCRPRIRPVPPHVSIGNSEIRYGLCVDALVDDAWWEGV
VFDHDEGFEERRVLFPDLGDQAILTIERLRLTQDWDEASGHWKPRGQWLFLQLLQNFDCA
GSLPVSIRQIWCNLRATHVFQDKIKSWAFGTKDIWEKLLSELIEEVWSAANTISVSDNSS
QAVLVVDATEVSGADGFLQSCDSTKASMKPRVCSKALQDFIQVCRNKFCPIDLKKKLYVL
RTFSILTSMHSKAENIPSCSVANNWKPLKLDASYCPGLVEVYASKMRGGKSRLKSLAKLD
CKSLSEKVKKHLVALGWTVEFREDAILRFRFSSPQGRIYYSLIKACSDLLHQKVDEECEY
SDDSEHDRSGCSTKRLHSIVDYRVNCSGRSFNCAASGNKKVEFRADEDIEPEYLPEAITE
YEGFMDLQVQNESTFSCNSSEFGERKFGRLRFKRVANLKKKSMPLSPSHGSTQTCLSGQE
ADCQKSKRRVASQSIKQDEKTGESFSSRVRRSSTSLQQLVESSSQHSAKTVLSWLIDNDI
LLPRQKVYCMCEKDRQSRKEGRINHSGIKCMCCKTVFDLASFAAHSDNRTQRPSATIFLS
DGRSLLQCQMQMMHASKQKNFPHIRLKGDLTQHQSDTICSICQDGGALILCDHCPSAFHV
TCMGLEDVPEGKWFCPSCRCGICDHSEYNHDVEQFTKTTMFSCDQCEGEYHVGCLRGERL
QQLGSCPNGNWFCSKKCLKYSINDNSDLGRFALEAMAEHHSKLCIALDVLHECFVPMTET
RTQSDLVADLLFNKESELKRLNFWGFYTMLLEKGDELVSVATFRVYGDKAAEMPLIGTRV
LYRRKGMCRLLVNELEKLLCSLGVERLLLPAVPQLLQTWTTSFGFTQMTSSDRLELSKYS
LLSFSGTTMCQKLLGAAKTVSGVPAGDLPFSNFSVINNSVINITIVMVTNTCTKLHIHMI
HIWRFTSTDDFCIELADGSDCDSSVILSTCCRHKTPQILP
Download sequence
Identical sequences M0TC82
GSMUA_Achr6P32880_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]