SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr6P33230_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr6P33230_001
Domain Number 1 Region: 25-250
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.4e-44
Family Ankyrin repeat 0.00012
Further Details:      
 
Domain Number 2 Region: 261-349
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000311
Family Ankyrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr6P33230_001
Sequence length 593
Comment pep:novel chromosome:MA1:6:32357640:32360300:1 gene:GSMUA_Achr6G33230_001 transcript:GSMUA_Achr6T33230_001 description:"Putative Ankyrin repeat-containing protein At5g02620"
Sequence
MDSSVGRQSFRRKKMTKQLTGKRDDTPLHSAARSGNLAVVNGLLSGADDEDLKELLSRQN
QAGETALFVAAEYGYVDVVQEMIKYYDVAAAGIKAKNGYDALHIAAKQGDVDVVKELLNA
LPELSLTVDLSNTTALHTAAAQGHIEVVNLLLEADKSLALIAKSNGKTALHSAARNGHLE
VVKSLLRKESGIAARTDKKGQTALHMAAKGTSLDLVQELLENEPSLLNLVDTKGNTALHI
AARKSRAQCVAGSEFEYRLHHLSFVKEYIYIYIYIYIYIYIYNESLQSTIFFEWTVTCWS
NGLLQIVRRLLEFKELETKAINKSGETALDTAEKMGNSDVTGMLLEHGVQSARAIRPSPN
PARELKQTVSDIKHEVHSQLEHTRQTRRRVQGIAKRLNKLHEDGLNNAINSNTVVAVLIA
TVAFAAIFTVPGEYVESDNLAPGLTLGEANVAHQTPFMIFFVFDSVALFISLAVVVVQTS
VVVIESKAKKQMMAIINKLMWIACVLISIAFLALCFIVVGRSQRWLAIGVTIMGTVILAT
TLATMLYWVIAHRIEAKKLRNIRRSSLSRSRSWSASGVSDSELFNSEYKMYAI
Download sequence
Identical sequences M0TCB6
GSMUA_Achr6P33230_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]