SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr6P33300_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr6P33300_001
Domain Number 1 Region: 541-647
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000000000653
Family N-acetyl transferase, NAT 0.031
Further Details:      
 
Domain Number 2 Region: 345-370
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000552
Family PHD domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr6P33300_001
Sequence length 661
Comment pep:novel chromosome:MA1:6:32417529:32424117:-1 gene:GSMUA_Achr6G33300_001 transcript:GSMUA_Achr6T33300_001 description:"Hypothetical protein"
Sequence
MVGIINSVLPMKTSPLGLAKEISHTTPGFTVESIFLRPAEYEFGSDPIMTMETSSFQTVI
EASAHLASNVASNVCSSNSGLEDQNYPDPVMDELLSLTQPTDVVSEITLNQSSSGPANEN
DVDPAPTIFTEPGSSVPAVQESAHLFSGLSSSLCKDSDLSAHDACIKQLQSLCILDDQSR
LAKRMLTLPDLPYLSNSNGNQLKLNVTAQGGSKQRFVIYSDRVNLLPALLINYGFLHVTS
FFFSPFFLFRDCSLHQLIFKENGLPNGSKLAYCVKGEKIKTGYKFRNGLICDCCNVEMSP
SQFEVHAGFHKRRQPYRHIYTSDGITLHELSIALFNSRTLTSSCSEMSCTICGTGGELVS
CDGCTKSFHTGAISSDKLRSRLILKAETDQLLCCTLCKYASSSRLTFLTIFLLSYNKCER
EYHIGCLKHHGVCDLKEVPMECNWFCCEDCDVIHASLRKLVNNGENFVPYWLLSMLKRNS
SLGEFADDREADIHWQILSGKYVRDDLLFHKIIGLFHEAFDPIVEGGQDLLSAMVHAEDV
AGKLLGGVYCTIITVKSVIISAGLFRVFGRNVAELPLVVTHEKYRGKGYFRVLFSLVERV
LYHLEVDHLIVPASKEVQSLWKDKLGFVEMSEERLQAHLKDYPLVMFETTTMLEKAVPRS
F
Download sequence
Identical sequences M0TCC3
GSMUA_Achr6P33300_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]