SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr6P33430_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr6P33430_001
Domain Number 1 Region: 16-240
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.48e-44
Family Ankyrin repeat 0.00053
Further Details:      
 
Domain Number 2 Region: 312-366
Classification Level Classification E-value
Superfamily RING/U-box 0.000000152
Family RING finger domain, C3HC4 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr6P33430_001
Sequence length 493
Comment pep:novel chromosome:MA1:6:32470378:32473638:1 gene:GSMUA_Achr6G33430_001 transcript:GSMUA_Achr6T33430_001 description:"E3 ubiquitin-protein ligase XB3"
Sequence
MGQGMSCACSGYDHDFFAAVQGGDLRAVESFIRSDPSLVFRTTIYDGLSALHVLSMILDR
SVNPDTVNRHKQTPLMLAVMHGKFACVQKLLEAGANILTFDSLNGRTCLHHAAYYGYADC
LQVILSAAQSATVADSWGFRRFVNVRDSSGATPLHLAARQTKPDCVHILLDNGALVSATT
GGYCCPGSTALHLAARGGSLDCVRELLAWGANRLQRDSSGRIPYAVALKRNHGACAALLN
PSAAEPLVWPSPLKFISELDPDAKALLEAALVVANRKREKKILKGIAYSLPSPTHSDEST
DDDTPEESDSELCYICFDQVCTIKVQDCGHQMCAHCMLALCCHNKPSSMSLCSSSPTCPF
CRSGISRLVIAKNRVKDEGDKDTISKLRRSRRSTNFSEGSSSLKGLSSVIGSCGKMTLGS
GHISDGNDMADKPSDEYYMLLCEERLQMGSENSAGFCIINNYSFSMFFSYPLSMRVCLSI
LHYNALMYFKNSL
Download sequence
Identical sequences M0TCD6
GSMUA_Achr6P33430_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]