SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr7P04730_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr7P04730_001
Domain Number 1 Region: 390-419,640-810
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.01e-21
Family G proteins 0.00087
Further Details:      
 
Domain Number 2 Region: 447-484,524-605
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 1.22e-19
Family Transducin (alpha subunit), insertion domain 0.0018
Further Details:      
 
Domain Number 3 Region: 111-180
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000576
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr7P04730_001
Sequence length 838
Comment pep:novel chromosome:MA1:7:3557028:3567586:1 gene:GSMUA_Achr7G04730_001 transcript:GSMUA_Achr7T04730_001 description:"Putative Guanine nucleotide-binding protein alpha-2 subunit"
Sequence
MDSMDVNSWQEMMRKILPPGTPIPEAPANLDYSIAIEYDGPPVSYELPRVDPVDLIPTAE
PALSRRRSASGTLSPGLDPIPLPVSRIAHCADHPSRSPQDSGSSESENSENKKLYHDFSG
SPQYVGVTRKDKRKKVCYRCGKRKWESKEVCLVCDSRYCSYCVLRAMGSMPEGRKCVGCI
GQPIDESKRSKLGKSSRTLSRLLSPLEVRQILKAEKECPTNQLRPDQLVVNGLPLRPEEM
AELLSCPIPPQKLKPGSYWYDKESGLWGKAKKPDRIISSNLNFTGKLQSDASKGNTLVYI
NGREITKVELRVLKLANVQCPRDTHFWVYDDGRYEEEGQNNIRGKIWESTITRLACSLFS
LPVPHPVPNGLKNEAPYVPRTIPDYLEQRRIQKLLLLGPQWSGTSTIFKQFKRIPVCGPP
STRRCRCFGPVKSDAGSQAKFLYGKKFSQEELENIKLMIQSNMYKYLSILLEGRERFEEE
ALALVKPKGTGSYDQHLTQGFPGQDENGAQQINQCVYSINGRLKQFSDWLLDIVAMGDLD
AFFPAATREYAPLVDEMWREPAIQETYKRRNELHFLPDIAEYFLSRAVEVSSNEYEPSEK
DILYAEGVTQGNGLAFIEFSLDDHSPMSELYNDNPDTHSQPLTKYQLIRVSVKGMNEGCK
WVEMFEDVRLVIFCVALSDYDQLAAPVNGSNKPLQNKMVQSKELFEATIRQPCFRDTPFV
LVLNKYDLFEEKIDRVPLSACEWLSEFSPVRIHHNNQSLAQQAYYYIAMKFKELYFSFTN
RKLFVWQGRGRDRPTVDEAFKYIREVLKWADEKEETYYLEDSFYSTTEVSASPFIRHE
Download sequence
Identical sequences M0TER3
GSMUA_Achr7P04730_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]