SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr7P16220_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr7P16220_001
Domain Number 1 Region: 245-454
Classification Level Classification E-value
Superfamily SET domain 2.49e-57
Family Histone lysine methyltransferases 0.0021
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr7P16220_001
Domain Number - Region: 114-162
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000115
Family PHD domain 0.016
Further Details:      
 
Domain Number - Region: 164-212
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.09
Family PHD domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr7P16220_001
Sequence length 500
Comment pep:novel chromosome:MA1:7:13438588:13459510:1 gene:GSMUA_Achr7G16220_001 transcript:GSMUA_Achr7T16220_001 description:"Histone-lysine N-methyltransferase ASHR3"
Sequence
MLDHDNLLPPAAPTTALIQPGDPSSSSSSSSSRPETLDGDADLDRKWSRRPRFPVSTRGT
CAVLKRERKAGKKVADGKASLEDHVRAWKEKRMAAGVSERECFLPFLTNAPRMVDCRICN
RCIYPGEEVQCSVLGCQEAYHLTCAKQLIGSFTAKIFKCPQHGCFVCKQKAYWRCVRCEV
AAHAKCAPWPADVIYLKNRPGRAVCWRHSSDWHLEKEHADTTWDVEEAFLRLPLPYADEE
FKMGCILKDVMENKTEPSPYVHIRRNVYLIKKKRDGTETGGGCTNCNANSTCKENCECSR
GLSISCSKDCHCSDMCRNRPFRKEKKIKVVKTEYCGWGVVALEVMEKGDFVIEYIGEVID
DALCEQRLWDMKHRGDQKFYMCEIHKDFIIDATFKGNTSRFLNHSCDPNCKLEKWQVDGE
TRVGVFASRSIDIGEPLTYDYRFVHFGPMVKCYCGASNCQEYLGSKKKINQMLSCWGCKR
KRSFMAHHAKQISFFQRYSL
Download sequence
Identical sequences M0TI09
GSMUA_Achr7P16220_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]