SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr7P17070_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr7P17070_001
Domain Number 1 Region: 1873-2023
Classification Level Classification E-value
Superfamily SET domain 4.32e-41
Family Histone lysine methyltransferases 0.0016
Further Details:      
 
Domain Number 2 Region: 1503-1564
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000377
Family PHD domain 0.015
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr7P17070_001
Domain Number - Region: 1720-1752
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0532
Family PHD domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr7P17070_001
Sequence length 2027
Comment pep:novel chromosome:MA1:7:18218625:18233835:1 gene:GSMUA_Achr7G17070_001 transcript:GSMUA_Achr7T17070_001 description:"ATXR, putative, expressed"
Sequence
MNLRHHFPSFLAQEAVLKDQVRSQEASASDTFNLSSYRLGKTELGNSFLALLSGKFSQLP
NSRMDVAKPQVSNDDKILSGSGCVVPSINIPPLPENHGDNAPGNWNELSSFVASRPSVNS
ASVHNSAQVAGNSYHDMDSIELVSPQSSKCSNTGFALNSTRSGWLTSSKSANGNKHATMD
VQASRIVSFEAKPPVSNNNSPFLRGHPLILAPNDISGWEWTGGSSTKGVFFGSKASNAPT
LVNNIGTISDIKSFGGSWRSAEPLNNSVVPSHPYTLVGHTAQEKSVNKVQDNEYQRYNLD
GCNLFQEKIHSSEQVIKSVLSKNQSMQIAKQSPTCVGSEKLHSTLCKGKEIIDHYLDTDG
VNYNTKFVDQSVALPCLWANNSVNHDCDISSNNFSIDTSLADKDGASNIELRLGQPSQKC
HIFAGSYPTPVLEFGATCNPKKPHFHQQLKQQVDNAYDRKKTSQSLHFTASETLCSNKRL
ERHATTAVNTYNHSESEDLSRSANKNPLISLFLSHLEGNSTSLSLDNFFNSSDHLPSRVP
SGDSPVKLKVSNPVGDATHGIERKSEASKLDFLNILDERKSLLAADNGIVKSVCIVKDNQ
IANTREIDTSFSKKCPQISVSVDASQTSFYPDQLSGMLQKLGGKIPKQHDLASVSNKDYC
NHAVHGSSDPVPSEMVGHDSLNSDIPMSLASTSLCSLEPKKKVLNTTQHLMDVNLKNFAF
RHMVGLTTQKSSTSLKKSPQHHKLCCLSSMEPQLDGCQDLEMQRDAGEGNYCRNYHEISK
IAIKSVHSCPSCQSGRGMDIFPGHPCHTGSTRSCNCTGSTQRVPLSSEKYCKRFSTCCIC
DVDEQPCLRLGRLGSNCFTGSLKHGMCNHKEHNSCLSQHCCSSVLPYCVSGFCTSGGNKT
FHALSERRVCGQAKVMHATPDHDKDYLIPDRKRICLAHCGCSKNKFVPRNDQKTSFWRDV
PKKVYADADISSTFKIAQALETTKRIGDQLDDCSPEFDGTRQSSQSTRAQKMFNMSSGSS
APVVTEVSTEVNNLTSCAANIRTTNMIHDLLVDEGSGNEKCGSSDEAVGGRECEETIHIM
GKVDVATPGFHHLAGHSSVGLIDELCLMSPLKTKRVRNMNKCCADQENVNKNLNFERTPK
TANRNESMELNGPDMLIPLSDYAFPSEIPNNLRHLEIDHSRSQGEVSPQPVSVKKKTHLS
TCGSSSVKRKRSSLSCNKSNFERFSIQHKLQEDIEKRILDDDHSLSRVETSRKKTKQVLA
AYLKQENSTRTGKPPKYMSLNCIGNTFSNIKTTLPKKSRPIVCGNSGIIYCGETDGDQKP
PKIISLSLILKNARRCSTVEVYNTSLGLDNELSSLKLLHEKDMPSSCSENGQNPKFLRIS
GENKGYSSKNGGYLDTLSAGKETDSVLGPGLHPKQLKSQSRPKQKDVHTQSLNRFGAKHR
HATKNSCLSASGINECSKSIEAENELNDFPSTTVGNVLLKNNQDHAGKLSQVSRRRCSQG
YKFPSFLLNSDSFCCVCGSSNQDDANHLIECNDCLIKVHQACYGVSKIPKGHWSCRPCKA
NSQNIVCVLCGYGGGAMTRALKCQNIVKSLLKAWRVSKTSYSGKSVPSESTENEFFNPSS
VGEVPKFDKCGLAPLGEIISDFSPKAALKLDMQMQTNFPESKNCMPEKFQTHNSITAGVL
DPSTKQWVHMVCGLWTPGTRCPNVDTMSTFDVSGALPAKKNIVCSICNRPGGSCIECRVP
TCCIPFHPWCAHQKGLLQSEIEGDDNERVGFYGRCPHHATLNSCLPDSHVMDPEEESPGN
NEWTCARTEGFKGRKREKGYKPNTQRPCDNGVCIVSQEQINAWLHINGQKSCTRGVVRQP
CSDVEYDLRKEYIRYKQSKGWKHLVVYKSGIHALGLYTSQFIARGAMVVEYVGEIVGLRV
ADKREAEYQSGRRIQYKSACYFFRIDKEHIIDATRKGGIARFVNHSCLPNCVAKVISIRN
EKKVVFFAERDINPGEEITYDYHFNSEDEGKKIPCFCNSRNCRRYLN
Download sequence
Identical sequences M0TI94
GSMUA_Achr7P17070_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]