SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr7P18180_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr7P18180_001
Domain Number 1 Region: 17-250
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.06e-49
Family Ankyrin repeat 0.00025
Further Details:      
 
Domain Number 2 Region: 322-377
Classification Level Classification E-value
Superfamily RING/U-box 0.00000053
Family RING finger domain, C3HC4 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr7P18180_001
Sequence length 441
Comment pep:novel chromosome:MA1:7:20979656:20982563:-1 gene:GSMUA_Achr7G18180_001 transcript:GSMUA_Achr7T18180_001 description:"E3 ubiquitin-protein ligase XB3"
Sequence
MGQGVSCAGSSYEHGFFSAVQDGHLETVRSAIDEDPSLLRRATIYDRLSALHIAAANGRV
EVLTLVLEKYGNPDIANRHKQTPLMLAAMHGKIACVQKLLEAGANILMFDSLNGRTCLHH
AAYYGHSNCLQAIISAARSTGVADSWGFARFVNVRDDNGATPLHLAAKQRRPDCVHILLD
HGALVCASTGGGYGYPGSTPLHLAAHGGSLDCVRKLLAWGADRLQRDSAGRIPYAVALKR
NHGACAALLNPSAAEPLVWPSPLKVISELGPDAKALLEVALTEANKEREKKILEGTKYSL
SPPAHWDAAIPDDSSEASDTELCSICFDQVCTIEVKDCGHQMCAHCMLALCCHNKPNPTT
LCLPSPSCPFCRCNIARLVVAKTHDKDEGEKGTTSKLRRSRRSHNFSAESSSFKTSAMGS
FSKMSRGTGCITDSEDMVDKP
Download sequence
Identical sequences M0TIK5
GSMUA_Achr7P18180_001 XP_009410017.1.42102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]