SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr7P19760_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr7P19760_001
Domain Number 1 Region: 1476-1558
Classification Level Classification E-value
Superfamily TAZ domain 1.28e-23
Family TAZ domain 0.00029
Further Details:      
 
Domain Number 2 Region: 1274-1345
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000459
Family ZZ domain 0.011
Further Details:      
 
Domain Number 3 Region: 1395-1463
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000129
Family ZZ domain 0.009
Further Details:      
 
Domain Number 4 Region: 920-960
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000753
Family PHD domain 0.005
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr7P19760_001
Domain Number - Region: 588-630
Classification Level Classification E-value
Superfamily TAZ domain 0.0327
Family TAZ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr7P19760_001
Sequence length 1591
Comment pep:novel chromosome:MA1:7:22665590:22689055:-1 gene:GSMUA_Achr7G19760_001 transcript:GSMUA_Achr7T19760_001 description:"Probable histone acetyltransferase HAC-like 1"
Sequence
MLGCSSYKILQRRTQALSEEWVRRLPEVVRRLEERIFKDSTRDVYLNLALEPVEHHLFSV
IKNVLNNNRPLSHHITSSASSTTSPTPGTLNNGSTNAATSVQLENPTITATGTIVSTQTT
ANMGNLISTTIGPTDAGNNASLNTSDGTVSNGYQHQAANFGLGSCTSSVMSSTSIQRQFS
QMIPTPAIDNQKAVSANYEFSDGAGFNSTESTVALRSFQQKKFFASQSSHILHSLGAQIG
AEMRSNVLHKSSPYGFSNGLVNGALGLIGNNMQLSRPAASESFLSPNIYASSPKPLQQNI
ERQHHHSRMPMKTTDEILHRSDSSGLSVMNNMNSVSLHLQSRANSGLLNHHASLQSMQLP
LNTRPQLLDHSEKTNYRSSQSTTELLLQSQQHLQQSPQQPNQAYAQFVHNQLQLPQRHQQ
SMQNQQLTLKNGPLRKSSMTSNVGEQLVAAHANVACSESLSLSAAQQVQSSELQTRHRPN
TFAEGHSKSAQFLGYLPSCQDFQVSVSEDSQQLLHPHLQSDGVLDNFGWISSGSQAELMQ
FQWHPQSLQRAQMPDKPSCQLQEELHQRRTGQDKAPQSHLSAREVNYRRDKSMRQHNYLK
QMRWLLFLHHARRLRDRIAANYKAHACALSDTVLMSEIKICANGIKTDTIPPEYSKDSQP
ASKRVKIQNISLFPNSEALQVCVPSGNEQYDFQEAQAPECKQTIVKISANSEVIVKMEEP
SGPGQEKLPIFGSDINENMSFTSCEKDNSVSNPVNSHVKQETMVVDMLLDQVASGVKQNP
DNQSTDQVTVSKSGKPKIKGVSLIELFTPEQIKEHIIGLRQWIGQSKAKAERNQAMERLM
TENSCQLCAVEKLIFEPPPIYCSRCGARIKRNAFYYTIGSGETRLYVCTPCYNEARGDTI
EAEGSTFLKTKLEKKRNDEETEEWWVQCDKCETWQHQICALFNGRRNDGEAEYTCPSCYM
QEIESGERKPLPQSAVLGAKDLPRTFLSDHIEQRLFKRLKQERQERSRHLGKTFDEVPSA
EGLVVRVVSSVDKKLEVKQQFLEIFEEENYPKEFPYKSKAILLFQKIEGVEVCLFGMYVQ
EFSSECSFPNQRRVYLSYLDSVKYFRPEIKTVTGEALRTFVYHEILIGYLEYCKKRGFTS
CYIWACPPLKGEDYILYCHPEIQKTPKSDKLREWYLTMLRKAAKENIAVDLTNLYDHFFV
TMGESKAKVTAARLPYFDGDYWPGAAEDMITQLRHEEDCRKQLKKGKTKKTIMKRALKAV
GQTDLSGNASKDALLMQKLGETICPMKEDFIMVHLQYACTHCCILMVSGTRWVCSKCNNF
QLCNKCHEAEQRVDERDRHPTNSREKHTLYPVEINDVAQDTKDKDDILESEFFDTRQAFL
SLCQGNHYQYDTLRRAKHSSMMVLYHLHNPTAPAFVTTCLVCHHDIESGHGWRCEICPDF
DVCNACYQKGGIDHPHMLTNHPSMVDHDAQNKEARAKRVLQLRKMLDLLVHASQCRSPQC
QYPNCRKVKGLFRHGIQCKIRASGGCVLCKKMWYLLQIHSRACKESDCGVPRCRDLKEHL
RRLQQQSDSRRRAAVMEMMRQRAAEVSANTN
Download sequence
Identical sequences M0TJ13
GSMUA_Achr7P19760_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]