SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr7P20630_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr7P20630_001
Domain Number 1 Region: 419-516
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000684
Family Ankyrin repeat 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr7P20630_001
Sequence length 630
Comment pep:novel chromosome:MA1:7:23712197:23715703:1 gene:GSMUA_Achr7G20630_001 transcript:GSMUA_Achr7T20630_001 description:"Squamosa promoter-binding-like protein 15"
Sequence
MEERSPSSSPPVTKKLFPLHSTMERQKYAEASECQEDNATIELSVSHGRSAQLQLFKESD
TLLEDGAVPSVMHRAGYKSSGSDHSPSSSNSDAQDRTGRITFKLFGKDPSCFPDTLRTQV
FSWLSNSPSEMESYIRPGCVVLSIYLSMPSIAWEELDDDLLQRVTSLVQYSDTEFWRNGR
FLVSTNKQLVSHKDGKIRLSKSWRAWSAPELTSISPVAIVGGQETSLVLKGRNLTVPGTK
IHCAYMGKYISKVLCSAYPGTIYDDSCVERFDFPGGSPRVFGRCFIEVENGFKGNSFPVI
IADASICQELRALESDIDEDVQMADAIPEEQVQSSVQPRSREDVMHFLNELGWLFQRTNA
PSSLTLLDFSITRFKYLFTFSVERDWCNLIKTLLDILVERSMRNDALEQESLEMLSEVHL
LIRAVNRKSKQMIDLLLHYCVCHGKDATKVYLFPPNMSGPGGMTPLHMAASMQDAEDIVD
ALTNDPQEVGINCWNSILDDSDQSPYMYATLRNNLSYNRLVARKLADRTNGQVTISVVGG
EISMDEPWVGLNRHGTSQTSQLTSCAQCALMGARPLRRTTYSRGLLQRPYVHSMLAIAAV
CVCVCLFFRGSPQIGSIEPFKWENLDFGPR
Download sequence
Identical sequences M0TJA0
GSMUA_Achr7P20630_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]