SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr7P20980_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr7P20980_001
Domain Number 1 Region: 210-519
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.29e-76
Family Regulator of chromosome condensation RCC1 0.0022
Further Details:      
 
Domain Number 2 Region: 13-121
Classification Level Classification E-value
Superfamily PH domain-like 6.35e-28
Family Pleckstrin-homology domain (PH domain) 0.0041
Further Details:      
 
Domain Number 3 Region: 518-587
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.39e-16
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0024
Further Details:      
 
Domain Number 4 Region: 946-1040
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000225
Family PAPS sulfotransferase 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr7P20980_001
Sequence length 1453
Comment pep:novel chromosome:MA1:7:23889360:23910000:-1 gene:GSMUA_Achr7G20980_001 transcript:GSMUA_Achr7T20980_001 description:"Protein-tyrosine sulfotransferase"
Sequence
MADPLRNGSVERDVEQAITALKKGAHLLKYGRRGKPKFCPFRLSNDESLLIWYSGKDEKQ
LKLSQVSKIIPGQRTAIFQRYPRPDKEYQSFSLIYNDRSLDLICKDKDEAEVWFVGLKAL
ISHGSHQKLRSESRGDRTSSDSPSTHTQKISPFTSPFSGKSLGKSISSYSSGAADNANGQ
ASAVDTVRVSLSSAVSSSSHGSGHEDFDALGDVFIWGEGLACGRGHAVLVTKQGEVFSWG
EESGGRLGHGNDADVFQPKLIDALSGMNVELKVCGPMEGQHVSSVSCGPWHTAIVTSAGQ
LFTFGDGIFGALGHGDRRSTNIPREVEALRGMRAVRAACGVWHTAAIVEILDASSDSGSS
STGKLFTWGDGDKGRLGHGDGETRLLPTCVVSLSDSFCKVACGHDITIGLTTSGRVYTMG
STVYGQLGNPEADGKLPTCVEGKIYNSFVEEISCGAYHVAVLTSRTEVYTWGKGTNGRLG
HGDSDDRNTPTLVEALKDKQVKSVVCGASFTAVICLHKWICSADQSICAGCHLPFGFRRK
RHNCYNCGSVFCKACSSKKSTGASLAPNINKPYRVCDECYTKLKKAMGDGKIPRFPKHQS
GSTNQMPGELADKDSLAPRMQGQFSRLSSVESFKGEGRDSRESNNRRHNPMPNQLRNLYP
SSSSKFFQASSKKIFSASVPGSRVASRSTSPTSCKPSSPHSMPTAPGIDLTCMENLDVDS
KPNNEDLRQEVIMLQAQVAELMCKSRLLEVELQKATKQLIDTKAIASEETAKCKAAKEVI
KSLTSQLKVMAEGVPEGCLISHNCGYSYTSDSLKLPSSDNITGNLLASQVSESNSNLGNP
LASNGNHTLPEAAEWVEQAEPGVYFTISFLPGGNKCLKRVRFSRKRFSEQQAEKWWSENR
SWLQEKYTILSASTLLLVSCGEDDYFHCESVVRNWVEYSSEDKTKEGELTLKDLLFFLHV
PRTGGRTYFHCFLRKLYTSGQECPRSYDKLHFDPRKPNCSLMVTHDDYSLLSKLPKDRTS
VVTIFRDPVDRVFSTYEFSVEVAARFLGHPNLTSATKMSGQIHRKSRGVSTLDIWPWKYL
VPWMRQDLFARRDTRELGRPRKIKEITNPYDVEEIVMPLHEFINDPMAHEIIHNGATFQV
AGLTNNSCKVDSHDVRNCVQKHPELGHFVLEVAKRRLNHMLYVGLTEEHKKSATLFAKLV
GAQVLSQSEALNSDFKQAISNKTGPTSFPDPKAKGSNQFEGSTNIRKDSEVPSPTHFELT
RENMSVGTLMEIYESCISTLRKSQASRRTMSLKRVAPVNFSKQARVSVPMTVLQQIQHLN
NLDVELYKHAQNIFMLQQKHLMQNAEDIFVQPDGDLMAEVEPQKAASGSFYRCLPWRLFL
AIALLMIIVLIVLATTTSRRTEKLKIYGRTTQLLQQKFREACSVMTGFNIILCCRQLVCQ
QPCVRFCSRHMNT
Download sequence
Identical sequences M0TJD5
GSMUA_Achr7P20980_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]