SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr7P22530_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr7P22530_001
Domain Number 1 Region: 404-545
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.83e-37
Family Pyk2-associated protein beta ARF-GAP domain 0.00032
Further Details:      
 
Domain Number 2 Region: 38-145,194-219
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.35e-29
Family BAR domain 0.0066
Further Details:      
 
Domain Number 3 Region: 644-733
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.21e-24
Family Ankyrin repeat 0.00093
Further Details:      
 
Domain Number 4 Region: 198-340
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-23
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr7P22530_001
Sequence length 740
Comment pep:novel chromosome:MA1:7:25006242:25013830:-1 gene:GSMUA_Achr7G22530_001 transcript:GSMUA_Achr7T22530_001 description:"ADP-ribosylation factor GTPase-activating protein AGD3"
Sequence
MYIYRQAWLVKLIDLLIVNYSWYPILILEIDSHFFWPQAREKYLALKKGTKADIATTLED
ELHIARSSFEQARFDLVTALSNIEAKKRYELLEAVTGIMEAHLRYFKQGYELLHQMEPYI
HQVLAYAQQSRDRSKYEQAALIERMQEFKRQIDRESRLSANGSHDSPNGDGIQAIGRSSH
KMIEAVMQSAAKGKVQTIRHGYLSKRSSNLRGDWKRRFFVLDSRGMLYYYRKQWIRSSVR
HHSNPRGHNSSEHGSGLLSRWFSSHYHGGVHDEKSVARHTVNLLTSTIKVDADQSDLRFC
FRIISPTKNYTLQAENAMDQMDWIEKITGVIASLLNSQSPEQHLLTSPMGGGHHRAASES
SSLGSSSDLDQLANEDSSLEKSSVSGHFDRCIRSSQHYRFNSKHEKPIDVLRKVCGNDEC
ADCGAPEPDWASLNLGILLCIECSGVHRNLGVHISKVRSLTLDVRVWDPSVISLFRSLGN
TFANSIWEESFLITSNGKSGDVSSLCTLDRNQEHCYISKPKHSDPIAVKEKFIQAKYAEK
HFVHKTADQLSKAQQMWDSVCANDTKAVYHHIVALDADVNITYRQASINSSLTLENTILL
ADQTSVAHDHRSSCLLGKSLQMSSTMSCISSSGTSDIRNEVDECLEGFTLLHLACLTSDI
GMVELLLQYGANVNSTDFKGRTPLHHCILRGRQLFAKLLLTRGANPRAIDEDGRTALQYA
LEGGNVDDEEIIILLANPNR
Download sequence
Identical sequences M0TJT9
GSMUA_Achr7P22530_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]