SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr7P22560_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr7P22560_001
Domain Number 1 Region: 248-430
Classification Level Classification E-value
Superfamily PUA domain-like 1.64e-65
Family SRA domain-like 0.00000378
Further Details:      
 
Domain Number 2 Region: 134-188
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000042
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 484-575
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000027
Family RING finger domain, C3HC4 0.0065
Further Details:      
 
Domain Number 4 Region: 6-64
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000465
Family PHD domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr7P22560_001
Sequence length 868
Comment pep:novel chromosome:MA1:7:25031970:25039417:-1 gene:GSMUA_Achr7G22560_001 transcript:GSMUA_Achr7T22560_001 description:"E3 ubiquitin-protein ligase ORTHRUS 2"
Sequence
MASPVDLPCDADGRCMVCEAVPPSPAEVVLCRTCATPWHAPCLSLPPATLATAVDWECPD
CSSPDGSGVVAAVPDASSALIASIRAIEADRSLTEKEKAWRRQELVGGRGRVLVERDKEE
EKKGKKMRNDDVLGFLDAKFICSFCMQLPDRPVTTPCGHNFCLKCFQKWVGQGKHSCAKC
RAPIPSKMACEPRINSAIVVAIRMAKTAQSTISSDKKREYHSMCNENRPDKAFTTERAKK
AGKANACSGQIFGVLVGEIWEDRLECRQWGAHLPHVAGIAGQSNQGAQSVALSGGYKDDE
DHGDWFLYTGSGGRDLSGNKRTNKHQSFDQTFEKLNKALQVSCIKGYPVRVVRSQKEKRS
SYAPETGVRYDGIYRIEKCWRKLGIQGFKVCRYLFVRCDNEPAPWTSDEQGDHPRPLPVI
NELKHATDITIRKQSPSWDYDEKHGWKWIKSPPKSRKHGPGGSPYERGRRKSSRTPQSTS
VREKLLKELSCLICWKVMSFPLTTPCAHNFCKSCLLGSFADKSFVRVRTWEGGWSLRAQK
IIKKCPSCPNDISDFLQNPQVNRELMDLIELLQKRKHEMNGEESSNLVDLSSEEENNDQE
KRLRNYGSDLGKNMVENESDVLKGKKLKGKAFDICEQQYKSVDGESETYAVNCEMDEIGK
TYCLGLKNKIVHCVTYKRRKTSCTLNGIRKTRSLGLTNKVVHYVTYKRRKLNCEMDEIGK
TSCLGLTNKVVHYVTYKRRKLHCEMVEIGKTSCLGLTNKVVHHVTYKRRKTNCEMDKIDK
TSCVGLTNKVVHYVTYKRRNTNYQMDKIDKTSCLGLTNKVVHYVTYKRRNTNYQMDKIDK
INCLGLTSKVVRYVTYKRRKTNPDSWKK
Download sequence
Identical sequences M0TJU2
GSMUA_Achr7P22560_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]