SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr7P23730_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr7P23730_001
Domain Number 1 Region: 20-261
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.23e-39
Family Ankyrin repeat 0.00052
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr7P23730_001
Domain Number - Region: 294-310
Classification Level Classification E-value
Superfamily Zinc hairpin stack 0.0863
Family Zinc hairpin stack 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr7P23730_001
Sequence length 317
Comment pep:novel chromosome:MA1:7:25803736:25806552:-1 gene:GSMUA_Achr7G23730_001 transcript:GSMUA_Achr7T23730_001 description:"Putative Ankyrin repeat-containing protein At5g02620"
Sequence
MDKQRSFRLGGGQQSFKERKNKESPGKRGDTELHLAARAGNAAHIRKIVSECSSESELKD
LVCKQNQDGETALYVAAEMGHVAAVPEILKVSDVQSAAIKAHNSYDAFHIAAKQGHLEVL
KDLLHSFPALAMTTNSLNSTALDTAATQGHIEIVNLLLETDASLAKIARNNGKTVLHSAA
RMGHVEVVKSLLDQDPSIGLRTDKKGQTAFHMAVKGQNVEMVLELLKPDVSIINLEDSKG
NRPLHIATRKGNPKAIALISHASSHLSDMNFGVCCFVKFIGMHASSVSFLLIDVFSNFWH
CRFCRLCYRWEESISMQ
Download sequence
Identical sequences M0TK59
GSMUA_Achr7P23730_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]