SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr8P02120_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr8P02120_001
Domain Number 1 Region: 27-292
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.48e-54
Family Ankyrin repeat 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr8P02120_001
Sequence length 538
Comment pep:novel chromosome:MA1:8:1570979:1572918:1 gene:GSMUA_Achr8G02120_001 transcript:GSMUA_Achr8T02120_001 description:"Ankyrin repeat-containing protein At5g02620"
Sequence
MDSPGGQQSIRRKKMTKQLTGKRDDTPLHSAARAGNLVVAKEILSGTNDGELKDLLCKQN
QVGETALFVAAEYGYVDVVHEMMKHYDVAMAEIRAKNGYDALHIAAKQGDVDVVKELLKA
LPELSLTVDLSNTTALNTAATQGHIDVVNLLLETDKSLALIARSNGKTALHSAARNGHLE
VVKALLRKESAIATRTDKKGQTALHMAVKATSLELVVELLESEPSLLNLVDTKGNTALHI
AARKGRAQIVKRLLEIKDLEIKAINKSGETALDTAEKMGHMEVASVLLEHGVPSARTMKP
PPANPARELKQTVSDIKHEVHSQLEHTRQTRRRVQGIAKRLNKLHQEGLNNAINSNTVVA
VLIASVAFAAIFTVPGEYVESDNLAPGLTLGEANVAHQTPFMIFFVFDSVALFISLAVVV
VQTSVVVIESKAKKQMMAIINKLMWIACVLISVAFLALCFIVVGRTQKWLAIGVTVIGTV
ILATTLGTMLYWVIAHRIEAKKMREIRRATLGRSRSWSVSGMSDSEWVNKEYKKMYAI
Download sequence
Identical sequences M0TLW4
XP_009412600.1.42102 GSMUA_Achr8P02120_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]