SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr8P03060_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr8P03060_001
Domain Number 1 Region: 152-506
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 7.41e-69
Family Regulator of chromosome condensation RCC1 0.017
Further Details:      
 
Domain Number 2 Region: 44-134
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.33e-21
Family Ankyrin repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr8P03060_001
Sequence length 1077
Comment pep:novel chromosome:MA1:8:2111479:2119077:-1 gene:GSMUA_Achr8G03060_001 transcript:GSMUA_Achr8T03060_001 description:"regulator of chromosome condensation/beta-lactamase-inhibitor protein II, putative, expressed"
Sequence
MEGLVPHSGSVRQTSNRKFSSSSSQKDLWFICKQGSVVELDLALLSLKKNGGNIDARNVF
GLTPLHIATWRNHVPIVKRLLAAGADPDSRDGESGWSSLHRALHFGHLAVASVLLQAGAS
LTLEDSKCRTPVDLLSGPVFLATGNASDSVATEVFSWGSGTNYQLGTGNAHIQKLPCKVD
ALQSSCIKIIAASKFHSVAVGSDGQLYTWGYGRGGRLGHPDFDVHSGQAAVITPRQVILG
LGTRRVKIVAAAKHHTVIATESGEVFTWGSNREGQLGYTSVDTQPTPRRVSSLKVKVIAV
AAGNKHSAAVAESGEVFTWGCNKEGQLGYGTSNSVSNSIPRMVEYLKGKVFRGVSAAKYH
TIVLGADGEVFTWGHRLVTPKRVVVSRNIKKSGNTPLKFHRMERLHVISVAAGVVHSTAL
TDDGALFYWVSSDPDLRCQQLYSICGTNIISISAGKYWTAAVTTTGDVYMWDGKKYKDGT
PIPARLHGIKRATSVCVGETHLLALCALYHPSYPLRSEVSVVEQLSDVNAEVEELDYDNS
FSDIEIDTSPKTIKNDVGSKDIPSLKSLCEKAAAELLLEPRNAIQLLEIADSLEADNLRK
HCEELAIHNLDYIFTVSASAIASASPEVLAKLEKLLDARSSEPWSYRRLPTPTATFPAII
NSDEEDIEKGHFRLRDNSDNVLTKQESSRVDCFVQTDMITDQTVFKQVRALKKKLQQIEI
LEAKQLNGHHLDDQQIAKIQTRSSLECALNELGFPLETESTLLSSGLSDGKGNKKAEISR
KQRRKPKQKATQSEVLSVNSEIFEEQNSVKGFPDIKTLEVAENMENTAVDVNAITRSITM
EDSSSKNEKAISLSHTNKTSHLTTSKKKNRKGGLSMFLSGALDDAPRHAPLPMPKNEGPA
WGGAKFTHTSLRDIQNEQSKTKEIIPMRSKGRCEDPTDPANSGKVRLGSFLPNISSPIVI
VPAEGVAGPDGEKSTPPWSSSGTSPGLNRPSLRDIQLQQEKRQVNISHSPKTKISGFSVS
SIGSPSEAGGPKDSVPNRWFKPETDAPSSIRSIQIEERAMKDLKRFYSSVKLVKPHH
Download sequence
Identical sequences M0TM58
XP_009412499.1.42102 XP_018686211.1.42102 GSMUA_Achr8P03060_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]